3300029756: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_5_stool_1

Overview

Basic Information

• IMG/M Taxon OID: 3300029756
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133095 | Gp0281956 | Ga0242840
• Sample Name: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_5_stool_1
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 164306255
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059106	Metagenome	134	N
F070093	Metagenome	123	N
F093883	Metagenome	106	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0242840_100045	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	153702
Ga0242840_100797	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae	31622
Ga0242840_125591	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	921

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0242840_100045	Ga0242840_1000451	F093883	MEEDKDIKKEIRDYLKEEADTHIRHWMAIKRESKRLYSEIEDRTKKIALKSSSLIKEEDFVSLHEMTHKIQMLNIEAVKVNSRLMFIIQLATSFGMDLDFDTTYASTAKSIMEDRTSGFVFYDDKERLRYADKELEDMFHDMSVTEVSKIGVVQSYELLMKQYNEFKE
Ga0242840_100797	Ga0242840_10079744	F070093	FLRGKIDPPMEPEQERLSKLYSGSGIHSLPELNPN
Ga0242840_125591	Ga0242840_1255913	F059106	VILLQKFVWIVDLKVREHLTEYLKKDIKYHRVIIGVFV