| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029414 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133117 | Gp0282959 | Ga0243798 |
| Sample Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 191717031 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia intestinalis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F056309 | Metagenome | 137 | N |
| F059106 | Metagenome | 134 | N |
| F070093 | Metagenome | 123 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243798_100067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Roseburia → Roseburia intestinalis | 202960 | Open in IMG/M |
| Ga0243798_100248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 109771 | Open in IMG/M |
| Ga0243798_100757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 46931 | Open in IMG/M |
| Ga0243798_100772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 46086 | Open in IMG/M |
| Ga0243798_101558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 19976 | Open in IMG/M |
| Ga0243798_110462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1966 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243798_100067 | Ga0243798_100067184 | F059106 | LQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV |
| Ga0243798_100248 | Ga0243798_1002481 | F056309 | RTCLRRTPSLSVVPLLLGVSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243798_100757 | Ga0243798_10075744 | F056309 | RTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243798_100772 | Ga0243798_10077244 | F056309 | TPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243798_101558 | Ga0243798_1015581 | F070093 | CPFRIDPPMEPEQERLSKLYSGSGIHSLSELNPKSTQTLS |
| Ga0243798_110462 | Ga0243798_1104621 | F026592 | QNRLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
| ⦗Top⦘ |