| Basic Information | |
|---|---|
| Family ID | F056309 |
| Family Type | Metagenome |
| Number of Sequences | 137 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.68 % |
| % of genes near scaffold ends (potentially truncated) | 89.05 % |
| % of genes from short scaffolds (< 2000 bps) | 16.06 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.080 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces (61.314 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut (86.131 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF00575 | S1 | 3.65 |
| PF00005 | ABC_tran | 3.65 |
| PF17147 | PFOR_II | 2.92 |
| PF06050 | HGD-D | 2.92 |
| PF08544 | GHMP_kinases_C | 2.19 |
| PF00664 | ABC_membrane | 2.19 |
| PF00082 | Peptidase_S8 | 2.19 |
| PF03466 | LysR_substrate | 2.19 |
| PF05175 | MTS | 1.46 |
| PF05746 | DALR_1 | 1.46 |
| PF02812 | ELFV_dehydrog_N | 1.46 |
| PF02934 | GatB_N | 1.46 |
| PF03553 | Na_H_antiporter | 1.46 |
| PF13556 | HTH_30 | 1.46 |
| PF06968 | BATS | 1.46 |
| PF00465 | Fe-ADH | 1.46 |
| PF00682 | HMGL-like | 1.46 |
| PF02492 | cobW | 1.46 |
| PF16189 | Creatinase_N_2 | 1.46 |
| PF02518 | HATPase_c | 1.46 |
| PF07683 | CobW_C | 1.46 |
| PF01497 | Peripla_BP_2 | 1.46 |
| PF00209 | SNF | 1.46 |
| PF12385 | Peptidase_C70 | 0.73 |
| PF01814 | Hemerythrin | 0.73 |
| PF12833 | HTH_18 | 0.73 |
| PF13407 | Peripla_BP_4 | 0.73 |
| PF04073 | tRNA_edit | 0.73 |
| PF02687 | FtsX | 0.73 |
| PF02632 | BioY | 0.73 |
| PF01022 | HTH_5 | 0.73 |
| PF02626 | CT_A_B | 0.73 |
| PF04079 | SMC_ScpB | 0.73 |
| PF11823 | Se_S_carrier | 0.73 |
| PF00871 | Acetate_kinase | 0.73 |
| PF02784 | Orn_Arg_deC_N | 0.73 |
| PF07866 | DUF1653 | 0.73 |
| PF06107 | DUF951 | 0.73 |
| PF00872 | Transposase_mut | 0.73 |
| PF01694 | Rhomboid | 0.73 |
| PF00710 | Asparaginase | 0.73 |
| PF01264 | Chorismate_synt | 0.73 |
| PF00160 | Pro_isomerase | 0.73 |
| PF01182 | Glucosamine_iso | 0.73 |
| PF04545 | Sigma70_r4 | 0.73 |
| PF01047 | MarR | 0.73 |
| PF05857 | TraX | 0.73 |
| PF01515 | PTA_PTB | 0.73 |
| PF00590 | TP_methylase | 0.73 |
| PF12784 | PDDEXK_2 | 0.73 |
| PF01261 | AP_endonuc_2 | 0.73 |
| PF12831 | FAD_oxidored | 0.73 |
| PF01554 | MatE | 0.73 |
| PF00485 | PRK | 0.73 |
| PF02978 | SRP_SPB | 0.73 |
| PF13247 | Fer4_11 | 0.73 |
| PF09084 | NMT1 | 0.73 |
| PF16124 | RecQ_Zn_bind | 0.73 |
| PF00860 | Xan_ur_permease | 0.73 |
| PF01144 | CoA_trans | 0.73 |
| PF04095 | NAPRTase | 0.73 |
| PF00854 | PTR2 | 0.73 |
| PF12673 | DUF3794 | 0.73 |
| PF04723 | GRDA | 0.73 |
| PF14622 | Ribonucleas_3_3 | 0.73 |
| PF01869 | BcrAD_BadFG | 0.73 |
| PF03462 | PCRF | 0.73 |
| PF06470 | SMC_hinge | 0.73 |
| PF02664 | LuxS | 0.73 |
| PF14277 | DUF4364 | 0.73 |
| PF00012 | HSP70 | 0.73 |
| PF03965 | Penicillinase_R | 0.73 |
| PF10035 | DUF2179 | 0.73 |
| PF01795 | Methyltransf_5 | 0.73 |
| PF06912 | DUF1275 | 0.73 |
| PF02371 | Transposase_20 | 0.73 |
| PF00155 | Aminotran_1_2 | 0.73 |
| PF04297 | UPF0122 | 0.73 |
| PF01979 | Amidohydro_1 | 0.73 |
| PF00814 | TsaD | 0.73 |
| PF02901 | PFL-like | 0.73 |
| PF01235 | Na_Ala_symp | 0.73 |
| PF01546 | Peptidase_M20 | 0.73 |
| PF02922 | CBM_48 | 0.73 |
| PF00440 | TetR_N | 0.73 |
| PF08353 | MurT_C | 0.73 |
| PF12993 | DUF3877 | 0.73 |
| PF04657 | DMT_YdcZ | 0.73 |
| PF00300 | His_Phos_1 | 0.73 |
| PF00486 | Trans_reg_C | 0.73 |
| PF08501 | Shikimate_dh_N | 0.73 |
| PF10369 | ALS_ss_C | 0.73 |
| PF03547 | Mem_trans | 0.73 |
| PF08352 | oligo_HPY | 0.73 |
| PF03030 | H_PPase | 0.73 |
| PF13394 | Fer4_14 | 0.73 |
| PF02806 | Alpha-amylase_C | 0.73 |
| PF12848 | ABC_tran_Xtn | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 2.92 |
| COG0733 | Na+-dependent transporter, SNF family | General function prediction only [R] | 1.46 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 1.46 |
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 1.46 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 1.46 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 1.46 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.46 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.46 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 1.46 |
| COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 1.46 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.73 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.73 |
| COG1854 | S-ribosylhomocysteine lyase LuxS, autoinducer biosynthesis | Signal transduction mechanisms [T] | 0.73 |
| COG1882 | Pyruvate-formate lyase | Energy production and conversion [C] | 0.73 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.73 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
| COG2739 | Predicted DNA-binding protein YlxM, UPF0122 family | Transcription [K] | 0.73 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 0.73 |
| COG3238 | Uncharacterized membrane protein YdcZ, DUF606 family | Function unknown [S] | 0.73 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.73 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.73 |
| COG1196 | Chromosome segregation ATPase Smc | Cell cycle control, cell division, chromosome partitioning [D] | 0.73 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.73 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.73 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.73 |
| COG4481 | Uncharacterized conserved protein, DUF951 family | Function unknown [S] | 0.73 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.73 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.73 |
| COG4728 | Uncharacterized conserved protein, DUF1653 family | Function unknown [S] | 0.73 |
| COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.73 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.73 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.73 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.73 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 0.73 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.73 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.73 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.73 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.73 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.73 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 0.73 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.73 |
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.73 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.73 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.73 |
| COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 0.73 |
| COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.73 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.08 % |
| Unclassified | root | N/A | 2.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000278|EM209_1069637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 538 | Open in IMG/M |
| 3300003146|Ga0051080_1020832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3444 | Open in IMG/M |
| 3300008360|Ga0114875_1002660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 12946 | Open in IMG/M |
| 3300010275|Ga0129310_1081591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 593 | Open in IMG/M |
| 3300013900|Ga0117820_1025894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 586 | Open in IMG/M |
| 3300014948|Ga0134487_100413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 18002 | Open in IMG/M |
| 3300014948|Ga0134487_102081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5338 | Open in IMG/M |
| 3300014948|Ga0134487_103437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3648 | Open in IMG/M |
| 3300023312|Ga0256721_113569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2373 | Open in IMG/M |
| 3300029011|Ga0169594_106145 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300029053|Ga0169665_107107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3617 | Open in IMG/M |
| 3300029053|Ga0169665_111418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2319 | Open in IMG/M |
| 3300029060|Ga0169602_1000592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 31323 | Open in IMG/M |
| 3300029099|Ga0169186_101748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 12215 | Open in IMG/M |
| 3300029106|Ga0169216_100702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 23753 | Open in IMG/M |
| 3300029126|Ga0168786_102430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 7073 | Open in IMG/M |
| 3300029126|Ga0168786_108560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1686 | Open in IMG/M |
| 3300029133|Ga0168787_103930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 7079 | Open in IMG/M |
| 3300029134|Ga0168775_106901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5119 | Open in IMG/M |
| 3300029134|Ga0168775_114982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2128 | Open in IMG/M |
| 3300029194|Ga0168692_100320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 30124 | Open in IMG/M |
| 3300029194|Ga0168692_104103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4500 | Open in IMG/M |
| 3300029219|Ga0168709_100262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 39784 | Open in IMG/M |
| 3300029220|Ga0168707_100035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 140833 | Open in IMG/M |
| 3300029231|Ga0168725_118366 | Not Available | 1429 | Open in IMG/M |
| 3300029234|Ga0168698_103019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10190 | Open in IMG/M |
| 3300029235|Ga0168722_106026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4808 | Open in IMG/M |
| 3300029248|Ga0168696_1001590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 14529 | Open in IMG/M |
| 3300029253|Ga0168699_1003098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8329 | Open in IMG/M |
| 3300029315|Ga0242753_100257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 78828 | Open in IMG/M |
| 3300029315|Ga0242753_105078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4835 | Open in IMG/M |
| 3300029328|Ga0242837_103986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5081 | Open in IMG/M |
| 3300029332|Ga0243782_101565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 20947 | Open in IMG/M |
| 3300029332|Ga0243782_110110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2879 | Open in IMG/M |
| 3300029333|Ga0243760_100179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 104442 | Open in IMG/M |
| 3300029333|Ga0243760_113043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2293 | Open in IMG/M |
| 3300029334|Ga0243717_1013678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1826 | Open in IMG/M |
| 3300029335|Ga0243762_100846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 42512 | Open in IMG/M |
| 3300029335|Ga0243762_102804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15816 | Open in IMG/M |
| 3300029335|Ga0243762_108922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4399 | Open in IMG/M |
| 3300029335|Ga0243762_110495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3602 | Open in IMG/M |
| 3300029335|Ga0243762_112016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3047 | Open in IMG/M |
| 3300029338|Ga0243718_1004803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5885 | Open in IMG/M |
| 3300029339|Ga0242823_1000522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 62870 | Open in IMG/M |
| 3300029339|Ga0242823_1000731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 49338 | Open in IMG/M |
| 3300029339|Ga0242823_1000959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 39262 | Open in IMG/M |
| 3300029339|Ga0242823_1001551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 23653 | Open in IMG/M |
| 3300029342|Ga0243726_1028667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1534 | Open in IMG/M |
| 3300029343|Ga0243725_1002085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 17234 | Open in IMG/M |
| 3300029343|Ga0243725_1004666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8649 | Open in IMG/M |
| 3300029348|Ga0243800_100049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 206073 | Open in IMG/M |
| 3300029348|Ga0243800_100311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 83405 | Open in IMG/M |
| 3300029348|Ga0243800_104352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4828 | Open in IMG/M |
| 3300029350|Ga0243859_101546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15292 | Open in IMG/M |
| 3300029356|Ga0243797_101533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 22488 | Open in IMG/M |
| 3300029358|Ga0243818_1008244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3686 | Open in IMG/M |
| 3300029360|Ga0243814_1007162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5028 | Open in IMG/M |
| 3300029361|Ga0243815_1001696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 19572 | Open in IMG/M |
| 3300029367|Ga0243974_100990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8825 | Open in IMG/M |
| 3300029372|Ga0243963_100446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 53943 | Open in IMG/M |
| 3300029372|Ga0243963_101219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 23020 | Open in IMG/M |
| 3300029372|Ga0243963_106466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3440 | Open in IMG/M |
| 3300029373|Ga0243914_105295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5515 | Open in IMG/M |
| 3300029375|Ga0243934_1001911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 23540 | Open in IMG/M |
| 3300029375|Ga0243934_1007713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5528 | Open in IMG/M |
| 3300029375|Ga0243934_1029947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1067 | Open in IMG/M |
| 3300029376|Ga0243980_1003755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8336 | Open in IMG/M |
| 3300029399|Ga0242750_100922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 17081 | Open in IMG/M |
| 3300029399|Ga0242750_101416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 11838 | Open in IMG/M |
| 3300029399|Ga0242750_101632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10506 | Open in IMG/M |
| 3300029407|Ga0243764_100852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 25097 | Open in IMG/M |
| 3300029407|Ga0243764_102837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8437 | Open in IMG/M |
| 3300029409|Ga0243858_101143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 22593 | Open in IMG/M |
| 3300029410|Ga0242843_118174 | Not Available | 1184 | Open in IMG/M |
| 3300029411|Ga0243861_101473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15649 | Open in IMG/M |
| 3300029414|Ga0243798_100248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 109771 | Open in IMG/M |
| 3300029414|Ga0243798_100757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 46931 | Open in IMG/M |
| 3300029414|Ga0243798_100772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 46086 | Open in IMG/M |
| 3300029419|Ga0243913_100919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 39493 | Open in IMG/M |
| 3300029420|Ga0243803_100424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 67990 | Open in IMG/M |
| 3300029425|Ga0243935_100905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 37969 | Open in IMG/M |
| 3300029426|Ga0242789_101832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 14934 | Open in IMG/M |
| 3300029428|Ga0242788_101257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 26026 | Open in IMG/M |
| 3300029430|Ga0243922_100885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 40565 | Open in IMG/M |
| 3300029430|Ga0243922_107638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea | 4492 | Open in IMG/M |
| 3300029431|Ga0243758_1001231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 27974 | Open in IMG/M |
| 3300029431|Ga0243758_1002304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 16013 | Open in IMG/M |
| 3300029431|Ga0243758_1002407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15405 | Open in IMG/M |
| 3300029431|Ga0243758_1018040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1484 | Open in IMG/M |
| 3300029433|Ga0243761_1002650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15949 | Open in IMG/M |
| 3300029433|Ga0243761_1019656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1616 | Open in IMG/M |
| 3300029433|Ga0243761_1022698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1355 | Open in IMG/M |
| 3300029434|Ga0243855_1000820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 41069 | Open in IMG/M |
| 3300029434|Ga0243855_1001034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 33703 | Open in IMG/M |
| 3300029462|Ga0244093_102067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 6814 | Open in IMG/M |
| 3300029465|Ga0244121_101126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 17965 | Open in IMG/M |
| 3300029484|Ga0244116_119682 | Not Available | 980 | Open in IMG/M |
| 3300029488|Ga0244072_130160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 808 | Open in IMG/M |
| 3300029491|Ga0244091_100025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 192783 | Open in IMG/M |
| 3300029511|Ga0244809_100205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 91045 | Open in IMG/M |
| 3300029511|Ga0244809_100535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 43460 | Open in IMG/M |
| 3300029511|Ga0244809_101311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 15439 | Open in IMG/M |
| 3300029519|Ga0244840_100875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 30071 | Open in IMG/M |
| 3300029521|Ga0244833_102870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 10083 | Open in IMG/M |
| 3300029530|Ga0244962_100112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 127845 | Open in IMG/M |
| 3300029530|Ga0244962_100651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 42160 | Open in IMG/M |
| 3300029556|Ga0244975_100781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 44224 | Open in IMG/M |
| 3300029557|Ga0245120_100128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 152626 | Open in IMG/M |
| 3300029564|Ga0244919_135484 | Not Available | 625 | Open in IMG/M |
| 3300029571|Ga0244922_109685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 3143 | Open in IMG/M |
| 3300029577|Ga0244883_123286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1142 | Open in IMG/M |
| 3300029586|Ga0243865_1000562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 48321 | Open in IMG/M |
| 3300029606|Ga0242783_103963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 6014 | Open in IMG/M |
| 3300029606|Ga0242783_108972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2784 | Open in IMG/M |
| 3300029620|Ga0245130_113813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2379 | Open in IMG/M |
| 3300029633|Ga0242758_100369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 45227 | Open in IMG/M |
| 3300029633|Ga0242758_101180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 13183 | Open in IMG/M |
| 3300029633|Ga0242758_106148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1927 | Open in IMG/M |
| 3300029665|Ga0243765_102844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 5547 | Open in IMG/M |
| 3300029665|Ga0243765_112356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1195 | Open in IMG/M |
| 3300029669|Ga0242751_104313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4607 | Open in IMG/M |
| 3300029732|Ga0245266_100614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 39593 | Open in IMG/M |
| 3300029735|Ga0245259_107318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3230 | Open in IMG/M |
| 3300029751|Ga0168701_102105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 8696 | Open in IMG/M |
| 3300029758|Ga0242784_100418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 59263 | Open in IMG/M |
| 3300029758|Ga0242784_101859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 13948 | Open in IMG/M |
| 3300029771|Ga0243801_100565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 61204 | Open in IMG/M |
| 3300029774|Ga0243768_101002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 30101 | Open in IMG/M |
| 3300029776|Ga0243759_101730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 20571 | Open in IMG/M |
| 3300029776|Ga0243759_107451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4799 | Open in IMG/M |
| 3300029779|Ga0243834_1037611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 896 | Open in IMG/M |
| 3300029790|Ga0242825_1000190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 133067 | Open in IMG/M |
| 3300029790|Ga0242825_1001326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 30373 | Open in IMG/M |
| 3300029794|Ga0243854_1024004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1731 | Open in IMG/M |
| 3300029841|Ga0245272_105541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 4355 | Open in IMG/M |
| 3300029841|Ga0245272_109210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2516 | Open in IMG/M |
| 3300029861|Ga0245310_114914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1792 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Human Feces | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces | 61.31% |
| Human Fecal | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal | 19.71% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 10.95% |
| Human Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated | 4.38% |
| Human | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human | 0.73% |
| Human Gut | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut | 0.73% |
| Huma Fecal | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Huma Fecal | 0.73% |
| Human Gut | Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut | 0.73% |
| Western Lowland Gorilla Individual Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Western Lowland Gorilla Individual Fecal | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000278 | Human fecal microbial communities from Cork, Ireland - EM209 | Host-Associated | Open in IMG/M |
| 3300003146 | Human fecal microbial communities from Washington University at St. Louis, Missouri, USA, of twins - TS28 | Host-Associated | Open in IMG/M |
| 3300008360 | Human stool microbial communities from NIH, USA - visit 1, subject 764224817 reassembly | Host-Associated | Open in IMG/M |
| 3300010275 | Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022A metagenome | Host-Associated | Open in IMG/M |
| 3300013900 | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 250 | Host-Associated | Open in IMG/M |
| 3300014948 | Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P271T2 | Host-Associated | Open in IMG/M |
| 3300023312 | Human gut microbial communities from healthy child feces in Northridge, California, USA -- CDI_12C | Host-Associated | Open in IMG/M |
| 3300029011 | Human fecal microbial communities from infant at 12 months in Denmark - 258_12M | Host-Associated | Open in IMG/M |
| 3300029053 | Human fecal microbial communities from mother in Denmark - 345_M | Host-Associated | Open in IMG/M |
| 3300029060 | Human fecal microbial communities from mother in Denmark - 263_M | Host-Associated | Open in IMG/M |
| 3300029099 | Human fecal microbial communities from infant at 12 months in Denmark - 128_12M | Host-Associated | Open in IMG/M |
| 3300029106 | Human fecal microbial communities from mother in Denmark - 172_M | Host-Associated | Open in IMG/M |
| 3300029126 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019844-87 | Host-Associated | Open in IMG/M |
| 3300029133 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019845-88 | Host-Associated | Open in IMG/M |
| 3300029134 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019832-40 | Host-Associated | Open in IMG/M |
| 3300029194 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011681-56 | Host-Associated | Open in IMG/M |
| 3300029219 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011712-136 | Host-Associated | Open in IMG/M |
| 3300029220 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011710-39 | Host-Associated | Open in IMG/M |
| 3300029231 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012069-37 | Host-Associated | Open in IMG/M |
| 3300029234 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011691-140 | Host-Associated | Open in IMG/M |
| 3300029235 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI012066-34 | Host-Associated | Open in IMG/M |
| 3300029248 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011688-36 | Host-Associated | Open in IMG/M |
| 3300029253 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011692-133 | Host-Associated | Open in IMG/M |
| 3300029315 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_5_stool_1 | Host-Associated | Open in IMG/M |
| 3300029328 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029332 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 042_10_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029333 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029334 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 023_10_31_stool_1 | Host-Associated | Open in IMG/M |
| 3300029335 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_31_stool_1 | Host-Associated | Open in IMG/M |
| 3300029338 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 024_10_24_stool_1 | Host-Associated | Open in IMG/M |
| 3300029339 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_2_stool_1 | Host-Associated | Open in IMG/M |
| 3300029342 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 025_10_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029343 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 025_10_26_stool_1 | Host-Associated | Open in IMG/M |
| 3300029348 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_29_stool_2 | Host-Associated | Open in IMG/M |
| 3300029350 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_11_stool_2 | Host-Associated | Open in IMG/M |
| 3300029356 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029358 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_12_stool_2 | Host-Associated | Open in IMG/M |
| 3300029360 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 045_3_9_stool_1 | Host-Associated | Open in IMG/M |
| 3300029361 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_10_stool_1 | Host-Associated | Open in IMG/M |
| 3300029367 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 082_5_2_stool_1 | Host-Associated | Open in IMG/M |
| 3300029372 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_5_2_stool_2 | Host-Associated | Open in IMG/M |
| 3300029373 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 076_4_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029375 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 079_4_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029376 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 091_4_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029399 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_3_stool_2 | Host-Associated | Open in IMG/M |
| 3300029407 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029409 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_11_stool_1 | Host-Associated | Open in IMG/M |
| 3300029410 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 016_6_6_stool_2 | Host-Associated | Open in IMG/M |
| 3300029411 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_13_stool_2 | Host-Associated | Open in IMG/M |
| 3300029414 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_28_stool_2 | Host-Associated | Open in IMG/M |
| 3300029419 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 076_4_27_stool_2 | Host-Associated | Open in IMG/M |
| 3300029420 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_31_stool_1 | Host-Associated | Open in IMG/M |
| 3300029425 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 079_4_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029426 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_3_stool_2 | Host-Associated | Open in IMG/M |
| 3300029428 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_3_stool_1 | Host-Associated | Open in IMG/M |
| 3300029430 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 077_4_27_stool_1 | Host-Associated | Open in IMG/M |
| 3300029431 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_28_stool_1 | Host-Associated | Open in IMG/M |
| 3300029433 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029434 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 053_3_8_stool_1 | Host-Associated | Open in IMG/M |
| 3300029462 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001848-98 | Host-Associated | Open in IMG/M |
| 3300029465 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001876-23 | Host-Associated | Open in IMG/M |
| 3300029484 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001871-18 | Host-Associated | Open in IMG/M |
| 3300029488 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001827-39 | Host-Associated | Open in IMG/M |
| 3300029491 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001846-96 | Host-Associated | Open in IMG/M |
| 3300029511 | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005376-42 | Host-Associated | Open in IMG/M |
| 3300029519 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012175-89 | Host-Associated | Open in IMG/M |
| 3300029521 | Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI012168-57 | Host-Associated | Open in IMG/M |
| 3300029530 | Human fecal microbial communities from Shanghai, China - P057V6 | Host-Associated | Open in IMG/M |
| 3300029556 | Human fecal microbial communities from Shanghai, China - P073V1 | Host-Associated | Open in IMG/M |
| 3300029557 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35705 | Host-Associated | Open in IMG/M |
| 3300029564 | Human fecal microbial communities from Shanghai, China - P033V1 | Host-Associated | Open in IMG/M |
| 3300029571 | Human fecal microbial communities from Shanghai, China - P034V6 | Host-Associated | Open in IMG/M |
| 3300029577 | Human fecal microbial communities from Shanghai, China - P012V1 | Host-Associated | Open in IMG/M |
| 3300029586 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 063_3_9_stool_1 | Host-Associated | Open in IMG/M |
| 3300029606 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_16_stool_1 | Host-Associated | Open in IMG/M |
| 3300029620 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35980 | Host-Associated | Open in IMG/M |
| 3300029633 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_7_stool_2 | Host-Associated | Open in IMG/M |
| 3300029665 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_27_stool_2 | Host-Associated | Open in IMG/M |
| 3300029669 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_4_stool_1 | Host-Associated | Open in IMG/M |
| 3300029732 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37878 | Host-Associated | Open in IMG/M |
| 3300029735 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37222 | Host-Associated | Open in IMG/M |
| 3300029751 | Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011698-46 | Host-Associated | Open in IMG/M |
| 3300029758 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 008_6_1_stool_1 | Host-Associated | Open in IMG/M |
| 3300029771 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_30_stool_1 | Host-Associated | Open in IMG/M |
| 3300029774 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 038_10_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029776 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_29_stool_1 | Host-Associated | Open in IMG/M |
| 3300029779 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 048_3_11_stool_1 | Host-Associated | Open in IMG/M |
| 3300029790 | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_1 | Host-Associated | Open in IMG/M |
| 3300029794 | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 053_3_14_stool_2 | Host-Associated | Open in IMG/M |
| 3300029841 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35629 | Host-Associated | Open in IMG/M |
| 3300029861 | Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37399 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| EM209_10696372 | 3300000278 | Human Fecal | LSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD* |
| Ga0051080_10208321 | 3300003146 | Huma Fecal | MWNAVRNTKRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD* |
| Ga0114875_10026601 | 3300008360 | Human | TVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD* |
| Ga0129310_10815912 | 3300010275 | Western Lowland Gorilla Individual Fecal | MPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSF |
| Ga0117820_10258941 | 3300013900 | Human Gut | MPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD*EAASPV |
| Ga0134487_10041322 | 3300014948 | Human Fecal | TCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKDREVASPLIN* |
| Ga0134487_1020811 | 3300014948 | Human Fecal | LSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFMD* |
| Ga0134487_1034371 | 3300014948 | Human Fecal | TCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD* |
| Ga0256721_1135692 | 3300023312 | Human Gut | MWNAVRNSWRVRSTVKGTKRTCLRRMPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0169594_1061452 | 3300029011 | Human Host-Associated | TCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0169665_1071071 | 3300029053 | Human Host-Associated | TPSLSVVPLFLGASDSLSVSYGMEPEQEALSTVSFKD |
| Ga0169665_1114183 | 3300029053 | Human Host-Associated | SLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD |
| Ga0169602_10005921 | 3300029060 | Human Host-Associated | RVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0169186_10174813 | 3300029099 | Human Host-Associated | TVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0169216_1007021 | 3300029106 | Human Host-Associated | TPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168786_1024301 | 3300029126 | Host-Associated | LRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168786_1085601 | 3300029126 | Host-Associated | PSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168787_1039301 | 3300029133 | Host-Associated | STVKGTKRTCLRRTPSLSVVPLLLGASDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168775_1069011 | 3300029134 | Host-Associated | CLRRTPSLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168775_1149821 | 3300029134 | Host-Associated | KGTKRTCLRRTPSLSVVPLLLGASDSLSVSYGMEPEQEALSIVSFKDREAASQLIN |
| Ga0168692_10032028 | 3300029194 | Host-Associated | RVRITVKGTKRTCLRRMPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVYFKD |
| Ga0168692_1041031 | 3300029194 | Host-Associated | TCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168709_1002621 | 3300029219 | Host-Associated | SLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168707_1000351 | 3300029220 | Host-Associated | TVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168725_1183661 | 3300029231 | Host-Associated | VKGTKRTCLRRTPSLSVVPLLLGDSGSLSVSYGIEPEQEALSIVFFKD |
| Ga0168698_1030191 | 3300029234 | Host-Associated | LRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKDREAASQLIN |
| Ga0168722_1060265 | 3300029235 | Host-Associated | CLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168696_10015901 | 3300029248 | Host-Associated | KRTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168699_100309810 | 3300029253 | Host-Associated | PSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0242753_1002571 | 3300029315 | Human Feces | VKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242753_1050784 | 3300029315 | Human Feces | LRRMPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242837_1039861 | 3300029328 | Human Feces | TVKGTKRTCLRRTPSLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243782_1015651 | 3300029332 | Human Feces | RTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243782_1101101 | 3300029332 | Human Feces | VRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243760_10017996 | 3300029333 | Human Feces | MWNAVRNTKRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243760_1130433 | 3300029333 | Human Feces | RRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIASFKD |
| Ga0243717_10136783 | 3300029334 | Human Feces | RTPSLNVVPLLLGDSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243762_10084649 | 3300029335 | Human Feces | MWNAVRNTKRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGM |
| Ga0243762_10280418 | 3300029335 | Human Feces | SLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKN |
| Ga0243762_1089221 | 3300029335 | Human Feces | RTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIASFKD |
| Ga0243762_1104954 | 3300029335 | Human Feces | LRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKDREDASQLIN |
| Ga0243762_1120163 | 3300029335 | Human Feces | STVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243718_10048035 | 3300029338 | Human Feces | CLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALAIVSFKD |
| Ga0242823_10005221 | 3300029339 | Human Feces | LSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKDREAVSPLIN |
| Ga0242823_100073123 | 3300029339 | Human Feces | MWNAVRSTVKGTKRTCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIASFKD |
| Ga0242823_10009591 | 3300029339 | Human Feces | RTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALFIVSFKD |
| Ga0242823_10015511 | 3300029339 | Human Feces | TPSLSVVPLLLGASDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243726_10286671 | 3300029342 | Human Feces | RRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243725_100208514 | 3300029343 | Human Feces | CLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSTVSFKDREAASLLID |
| Ga0243725_10046669 | 3300029343 | Human Feces | KRTCLRRTPSLSVVPLLLGDSDSLSVSYGMKPEQEALSIVSFKD |
| Ga0243800_1000491 | 3300029348 | Human Feces | TCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243800_10031179 | 3300029348 | Human Feces | PSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243800_1043521 | 3300029348 | Human Feces | RMCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243859_1015461 | 3300029350 | Human Feces | TPSLSVVPLLLGDSDSLSVSYGMEPEQEALSLVSFKD |
| Ga0243797_1015331 | 3300029356 | Human Feces | GTKRTCLRRTPSLSVVSLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243818_10082441 | 3300029358 | Human Feces | PSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0243814_10071626 | 3300029360 | Human Feces | MCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0243815_10016961 | 3300029361 | Human Feces | TKRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243974_1009901 | 3300029367 | Human Feces | TKRTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243963_1004461 | 3300029372 | Human Feces | RRMPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243963_1012191 | 3300029372 | Human Feces | TCLRRMPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243963_1064664 | 3300029372 | Human Feces | RTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243914_1052956 | 3300029373 | Human Feces | STVKGTKRTCLRRTPSLSVVPLLFGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243934_100191123 | 3300029375 | Human Feces | TPSLNVVPLLLGDSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243934_10077131 | 3300029375 | Human Feces | LRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSLVSFKD |
| Ga0243934_10299472 | 3300029375 | Human Feces | KGTKRTCLRRTPSLSVVPLFLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243980_10037551 | 3300029376 | Human Feces | PSLNVVPLLLGDSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0242750_10092217 | 3300029399 | Human Feces | MWNAVRNTKRVRSTVKETKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242750_10141613 | 3300029399 | Human Feces | CLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0242750_10163210 | 3300029399 | Human Feces | TKRMCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243764_1008521 | 3300029407 | Human Feces | GTKRTCLRRTPSLSVVPLFLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243764_1028371 | 3300029407 | Human Feces | RSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243858_10114323 | 3300029409 | Human Feces | CLRRMPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242843_1181742 | 3300029410 | Human Feces | SLSVVPLLLGDSGSLSVSYGMEPEQEALSIASFKD |
| Ga0243861_10147315 | 3300029411 | Human Feces | CLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243798_1002481 | 3300029414 | Human Feces | RTCLRRTPSLSVVPLLLGVSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243798_10075744 | 3300029414 | Human Feces | RTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243798_10077244 | 3300029414 | Human Feces | TPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243913_1009191 | 3300029419 | Human Feces | MWNAVRNSWRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243803_10042466 | 3300029420 | Human Feces | RSTVKGTKRTCLRRTPSLSVVPLLLGVSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243935_1009051 | 3300029425 | Human Feces | RTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242789_1018321 | 3300029426 | Human Feces | RRMPSLSVVPLLLGDSDSLTVSYGMEPEQEALSIVSFKD |
| Ga0242788_10125710 | 3300029428 | Human Feces | VXXXXPSLSVVPLLLGDSDSLSVSYGYGMEPEQEALSIVSFKD |
| Ga0243922_1008851 | 3300029430 | Human Feces | TKRTCLRRTPSLNVVPLLLGDSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243922_1076384 | 3300029430 | Human Feces | MCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0243758_100123132 | 3300029431 | Human Feces | KGTKRTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKN |
| Ga0243758_10023041 | 3300029431 | Human Feces | PSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0243758_10024071 | 3300029431 | Human Feces | KRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243758_10180403 | 3300029431 | Human Feces | TCLRRTPSLSVVPLFLGASDSLSVSYGMEPEQEALSTVSFKD |
| Ga0243761_10026501 | 3300029433 | Human Feces | VKGTKRTCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0243761_10196563 | 3300029433 | Human Feces | TVKGTKRTCLRRTPSLSVVPLFLGASDSLSVSYGMEPEQEALSTVSFKD |
| Ga0243761_10226983 | 3300029433 | Human Feces | CLRRTPSLSVVPLLLGDSDSLSVSYGIEPEQEALSIVSFKD |
| Ga0243855_100082034 | 3300029434 | Human Feces | MWNAVRNSWRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0243855_10010341 | 3300029434 | Human Feces | SLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0244093_1020671 | 3300029462 | Human Fecal | VRNTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALAIVSFKD |
| Ga0244121_1011261 | 3300029465 | Human Fecal | VKGTKRTCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVFFKD |
| Ga0244116_1196822 | 3300029484 | Human Fecal | TPSLSVVPLLLGDSDSLSVSYGMEPEQEALAIVSFKD |
| Ga0244072_1301601 | 3300029488 | Human Fecal | SLSVVPLLLGDSGSLSVSYGMEPEQEALSIVFFKD |
| Ga0244091_100025228 | 3300029491 | Human Fecal | SLSVVPLLLGASDSLSVSYGMEPEQEALSIVSFKD |
| Ga0244809_10020538 | 3300029511 | Human Fecal | XXXSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKN |
| Ga0244809_10053515 | 3300029511 | Human Fecal | MWNAVRNTKRVRSTVKGTKRTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0244809_1013111 | 3300029511 | Human Fecal | STVKGTKRTCLRRTPSLSVVLLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0244840_1008751 | 3300029519 | Human Fecal | SLSVVPLLLGGSDSLSVSYGMEPEQEALSIVYFKD |
| Ga0244833_1028701 | 3300029521 | Human Fecal | SLSVVPLFLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0244962_100112138 | 3300029530 | Human Fecal | TKRTCLRRTPSLSVVPLLLGGSDSLNVSYGMEPEQEALSIVSFKD |
| Ga0244962_1006511 | 3300029530 | Human Fecal | TKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSTVSFKD |
| Ga0244975_10078115 | 3300029556 | Human Fecal | MLNAVRNTKRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFMD |
| Ga0245120_100128146 | 3300029557 | Human Fecal | TCLRRTPSLSVVPLLLGDSDSLSVSCGMEPEQEALSIVSFKD |
| Ga0244919_1354841 | 3300029564 | Human Fecal | KGTKRTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEAISIVSFKD |
| Ga0244922_1096851 | 3300029571 | Human Fecal | VRTTVKGKKRTCLRRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0244883_1232861 | 3300029577 | Human Fecal | VKGTKRTCLRRTPSLSVVPLLLGASDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243865_10005621 | 3300029586 | Human Feces | CLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSLVSFKD |
| Ga0242783_1039631 | 3300029606 | Human Feces | LRRMPSLSVVPLLLGDSDSLSVSYGYGMEPEQEALSIVSFKD |
| Ga0242783_1089724 | 3300029606 | Human Feces | STVKGTKRTCLRRTPSLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD |
| Ga0245130_1138131 | 3300029620 | Human Fecal | KRTCLRRTPSLSVVPLFLGGSDSLTVSYGMEPEQEALSIVSFKD |
| Ga0242758_1003691 | 3300029633 | Human Feces | TCLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0242758_1011801 | 3300029633 | Human Feces | RRTPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242758_1061482 | 3300029633 | Human Feces | GTKRMCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0243765_1028441 | 3300029665 | Human Feces | GTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSLVSFKD |
| Ga0243765_1123563 | 3300029665 | Human Feces | SLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFMD |
| Ga0242751_1043134 | 3300029669 | Human Feces | RVRSTVKGTKRTCLRRTPSLSVVPLFLGASDSLSVSYGMEPEQEALSTVSFKD |
| Ga0245266_1006141 | 3300029732 | Human Fecal | RTPSLSVVPLLLGDSDSLSASYGMEPEQEALSIVSFKD |
| Ga0245259_1073183 | 3300029735 | Human Fecal | MPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0168701_1021059 | 3300029751 | Host-Associated | CLRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVFFKD |
| Ga0242784_1004181 | 3300029758 | Human Feces | KSTVKGTKRTCLRRTPSLSVVPLLLGDFDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242784_1018591 | 3300029758 | Human Feces | TVKGTKRTCLRRMPSLSVVPLLLGDSDSLTVSYGMEPEQEALSIVSFKD |
| Ga0243801_1005651 | 3300029771 | Human Feces | RTCLRRMPSLSVVPLLLGGSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243768_1010021 | 3300029774 | Human Feces | VKGTKRTCLRRTPSLNVVPLLLGDSDSLSVSYGMEPEQEALSIVFFKD |
| Ga0243759_1017301 | 3300029776 | Human Feces | KGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243759_1074511 | 3300029776 | Human Feces | SLSVVPLLLGDSDSLSVSYGMEPEQEALSIASFKD |
| Ga0243834_10376112 | 3300029779 | Human Feces | RTCLRRTPSLSVVPLFLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0242825_10001901 | 3300029790 | Human Feces | RSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKDREAVSPLIN |
| Ga0242825_10013261 | 3300029790 | Human Feces | GTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0243854_10240043 | 3300029794 | Human Feces | LRRTPSLSVVPLLLGDSGSLSVSYGMEPEQEALSIVSFKD |
| Ga0245272_1055411 | 3300029841 | Human Fecal | PSLSVVSLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| Ga0245272_1092103 | 3300029841 | Human Fecal | CLRRTPSLSVVPLLLGDSDSLTVSYGMEPEQEALSIVSFKD |
| Ga0245310_1149143 | 3300029861 | Human Fecal | VKGTKRTCLRRMPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD |
| ⦗Top⦘ |