NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029779

3300029779: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 048_3_11_stool_1



Overview

Basic Information
IMG/M Taxon OID3300029779 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133117 | Gp0282995 | Ga0243834
Sample NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 048_3_11_stool_1
Sequencing StatusPermanent Draft
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size205682918
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026489Metagenome197N
F056309Metagenome137N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0243834_1037611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes896Open in IMG/M
Ga0243834_1059328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii576Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0243834_1037611Ga0243834_10376112F056309RTCLRRTPSLSVVPLFLGDSDSLSVSYGMEPEQEALSIVSFKD
Ga0243834_1059328Ga0243834_10593281F026489EGCSLLTPKENQKSASDFDALEPRKRGCSPLLTPKKWATPEKTEDSRLFGVKIF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.