3300029669: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_4_stool_1

Overview

Basic Information

• IMG/M Taxon OID: 3300029669
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133095 | Gp0281867 | Ga0242751
• Sample Name: Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 001_6_4_stool_1
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 119190996
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056309	Metagenome	137	N
F101356	Metagenome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0242751_104313	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena	4607

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0242751_104313	Ga0242751_1043134	F056309	RVRSTVKGTKRTCLRRTPSLSVVPLFLGASDSLSVSYGMEPEQEALSTVSFKD
Ga0242751_129052	Ga0242751_1290522	F101356	DVGELIPVVTPGKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPSSDFCVYIAGNTMELQDTTKVYVKYMYGQPNSDTYLKMKYESDHRISIYLTSDNSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIVQ