| Basic Information | |
|---|---|
| Family ID | F036294 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 170 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDREVGAEGWNM |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 170 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 35.29 % |
| % of genes near scaffold ends (potentially truncated) | 18.24 % |
| % of genes from short scaffolds (< 2000 bps) | 71.76 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment (8.823 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.353 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (22.941 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 170 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 22.94 |
| PF00078 | RVT_1 | 12.94 |
| PF04002 | RadC | 0.59 |
| PF07927 | HicA_toxin | 0.59 |
| PF09709 | Cas_Csd1 | 0.59 |
| PF01695 | IstB_IS21 | 0.59 |
| PF00589 | Phage_integrase | 0.59 |
| PF01269 | Fibrillarin | 0.59 |
| PF01558 | POR | 0.59 |
| PF04986 | Y2_Tnp | 0.59 |
| PF01609 | DDE_Tnp_1 | 0.59 |
| PF14319 | Zn_Tnp_IS91 | 0.59 |
| PF03480 | DctP | 0.59 |
| PF14539 | DUF4442 | 0.59 |
| PF01569 | PAP2 | 0.59 |
| PF08546 | ApbA_C | 0.59 |
| PF14366 | DUF4410 | 0.59 |
| PF14294 | DUF4372 | 0.59 |
| PF00497 | SBP_bac_3 | 0.59 |
| PF13470 | PIN_3 | 0.59 |
| PF04365 | BrnT_toxin | 0.59 |
| PF12831 | FAD_oxidored | 0.59 |
| PF09957 | VapB_antitoxin | 0.59 |
| COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
|---|---|---|---|
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.59 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.59 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.59 |
| COG1889 | Fibrillarin-like rRNA 2'-O-methylase NOP1 | Translation, ribosomal structure and biogenesis [J] | 0.59 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.59 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 0.59 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.59 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.59 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.59 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.59 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.59 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.06 % |
| Unclassified | root | N/A | 22.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2038011002|Coalbed1143_GAIGPUK01BLPU8 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 2084038021|ASA129_GJG7ZZE02HFAUJ | Not Available | 567 | Open in IMG/M |
| 3300000119|KGI_S1_ANT01_95mDRAFT_c10032486 | Not Available | 2050 | Open in IMG/M |
| 3300000119|KGI_S1_ANT01_95mDRAFT_c10063963 | Not Available | 1221 | Open in IMG/M |
| 3300000120|SA_S2_NOR13_50mDRAFT_c1007163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 2079 | Open in IMG/M |
| 3300000120|SA_S2_NOR13_50mDRAFT_c1007279 | Not Available | 2055 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10033167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 2075 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10037399 | Not Available | 1912 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10000657 | All Organisms → cellular organisms → Bacteria | 15233 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10049914 | Not Available | 1736 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10059102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1540 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10085253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 1181 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10110979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300000133|SA_S1_NOR02_45mDRAFT_c1038029 | Not Available | 554 | Open in IMG/M |
| 3300000135|KGI_S1_ANT03_95mDRAFT_c1037431 | Not Available | 585 | Open in IMG/M |
| 3300000232|TB_PC08_64DRAFT_1014991 | Not Available | 2595 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1057182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 774 | Open in IMG/M |
| 3300000353|ElkS_mat_MD6ADRAFT_1012526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2098 | Open in IMG/M |
| 3300001256|JGI12210J13797_11057125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 639 | Open in IMG/M |
| 3300001256|JGI12210J13797_11057126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 1240 | Open in IMG/M |
| 3300001685|JGI24024J18818_10104411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 907 | Open in IMG/M |
| 3300001750|JGI24023J19991_10012400 | All Organisms → cellular organisms → Bacteria | 4800 | Open in IMG/M |
| 3300001750|JGI24023J19991_10039321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. EFPC1 | 2052 | Open in IMG/M |
| 3300001750|JGI24023J19991_10091546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 1007 | Open in IMG/M |
| 3300002027|MIS_10046961 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300002027|MIS_10101670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 2041 | Open in IMG/M |
| 3300002231|KVRMV2_100099245 | All Organisms → cellular organisms → Bacteria | 6806 | Open in IMG/M |
| 3300002700|draft_1438283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3239 | Open in IMG/M |
| 3300003154|Ga0052186_10101228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2787 | Open in IMG/M |
| 3300003332|GBSed_10032230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2043 | Open in IMG/M |
| 3300003513|FS828DNA_1006934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300003537|FS903DNA_1084195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 542 | Open in IMG/M |
| 3300003543|FS898DNA_10085703 | Not Available | 1636 | Open in IMG/M |
| 3300003543|FS898DNA_10266172 | Not Available | 1635 | Open in IMG/M |
| 3300004003|Ga0055445_10175442 | Not Available | 726 | Open in IMG/M |
| 3300004154|Ga0066603_10483379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300005264|Ga0073581_109247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7297 | Open in IMG/M |
| 3300005588|Ga0070728_10273501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 921 | Open in IMG/M |
| 3300005588|Ga0070728_10604770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 567 | Open in IMG/M |
| 3300005613|Ga0074649_1226447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 552 | Open in IMG/M |
| 3300005753|Ga0077776_1153706 | Not Available | 1134 | Open in IMG/M |
| 3300005832|Ga0074469_10566081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 650 | Open in IMG/M |
| 3300005920|Ga0070725_10388445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 621 | Open in IMG/M |
| 3300006231|Ga0082391_124066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 732 | Open in IMG/M |
| 3300006467|Ga0099972_10861614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
| 3300006467|Ga0099972_11870929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300006467|Ga0099972_12097907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 500 | Open in IMG/M |
| 3300006467|Ga0099972_12098887 | Not Available | 2159 | Open in IMG/M |
| 3300006467|Ga0099972_12466701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300006467|Ga0099972_13083087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 28340 | Open in IMG/M |
| 3300006467|Ga0099972_13511057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica | 606 | Open in IMG/M |
| 3300007769|Ga0102952_1013011 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300007771|Ga0105700_1104310 | Not Available | 1732 | Open in IMG/M |
| 3300007772|Ga0105672_1140288 | Not Available | 1297 | Open in IMG/M |
| 3300007776|Ga0105674_1222778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300007777|Ga0105711_1004562 | Not Available | 2251 | Open in IMG/M |
| 3300007778|Ga0102954_1224448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300008008|Ga0100399_1154929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 946 | Open in IMG/M |
| 3300008340|Ga0115359_10003580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2296 | Open in IMG/M |
| 3300008469|Ga0115369_10007925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4482 | Open in IMG/M |
| 3300009033|Ga0102956_1253175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 597 | Open in IMG/M |
| 3300009061|Ga0102938_10553672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 580 | Open in IMG/M |
| 3300009078|Ga0105106_10488020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 886 | Open in IMG/M |
| 3300009083|Ga0105047_10128256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3091 | Open in IMG/M |
| 3300009086|Ga0102812_10673051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 569 | Open in IMG/M |
| 3300009087|Ga0105107_10341194 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300009165|Ga0105102_10637843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica | 592 | Open in IMG/M |
| 3300009166|Ga0105100_11002811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 523 | Open in IMG/M |
| 3300009379|Ga0118737_1005154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2081 | Open in IMG/M |
| 3300009506|Ga0118657_10279096 | Not Available | 2262 | Open in IMG/M |
| 3300009513|Ga0129285_10111523 | Not Available | 1107 | Open in IMG/M |
| 3300009538|Ga0129287_10032878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2238 | Open in IMG/M |
| 3300009848|Ga0118742_104746 | Not Available | 2132 | Open in IMG/M |
| 3300009874|Ga0131789_10004897 | Not Available | 2404 | Open in IMG/M |
| 3300009874|Ga0131789_10084662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300009874|Ga0131789_10133043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300010228|Ga0136269_1015157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 836 | Open in IMG/M |
| 3300010330|Ga0136651_10025912 | Not Available | 3212 | Open in IMG/M |
| 3300010330|Ga0136651_10051918 | Not Available | 2206 | Open in IMG/M |
| 3300010330|Ga0136651_10052245 | Not Available | 2197 | Open in IMG/M |
| 3300010330|Ga0136651_10127376 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300010392|Ga0118731_109917324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300010392|Ga0118731_111112949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300010392|Ga0118731_113040574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 713 | Open in IMG/M |
| 3300010392|Ga0118731_115234318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1106 | Open in IMG/M |
| 3300010410|Ga0136992_10060793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 614 | Open in IMG/M |
| 3300010430|Ga0118733_100517545 | Not Available | 2370 | Open in IMG/M |
| 3300010430|Ga0118733_101268228 | Not Available | 1471 | Open in IMG/M |
| 3300010430|Ga0118733_104505672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300010932|Ga0137843_1003900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 3636 | Open in IMG/M |
| 3300011118|Ga0114922_11651318 | Not Available | 514 | Open in IMG/M |
| 3300011255|Ga0151667_1004005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1113 | Open in IMG/M |
| 3300013099|Ga0164315_10102513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2315 | Open in IMG/M |
| 3300013099|Ga0164315_10179047 | Not Available | 1728 | Open in IMG/M |
| 3300013099|Ga0164315_10203234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica | 1616 | Open in IMG/M |
| 3300013099|Ga0164315_10437497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 1060 | Open in IMG/M |
| 3300013099|Ga0164315_10814267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300013099|Ga0164315_11078565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300013101|Ga0164313_10653307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 868 | Open in IMG/M |
| 3300013101|Ga0164313_10758949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300013101|Ga0164313_11084845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300013103|Ga0164318_10238266 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300013103|Ga0164318_10877666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 745 | Open in IMG/M |
| 3300013103|Ga0164318_10890487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 739 | Open in IMG/M |
| 3300013103|Ga0164318_11397638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 564 | Open in IMG/M |
| 3300013103|Ga0164318_11443349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → methanotrophic bacterial endosymbiont of Bathymodiolus sp. | 553 | Open in IMG/M |
| 3300013233|Ga0172420_11025865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300013293|Ga0120688_1008588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 783 | Open in IMG/M |
| 3300013315|Ga0173609_10132815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 582 | Open in IMG/M |
| 3300014206|Ga0172377_10660358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300014257|Ga0075319_1026527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfogranum → Desulfogranum japonicum | 951 | Open in IMG/M |
| 3300014312|Ga0075345_1169310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 536 | Open in IMG/M |
| 3300014613|Ga0180008_1071742 | Not Available | 1370 | Open in IMG/M |
| 3300014914|Ga0164311_10474354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300017960|Ga0180429_10297090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300019757|Ga0193964_1045322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300019761|Ga0193955_1018891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2231 | Open in IMG/M |
| 3300019763|Ga0193962_1049912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 1106 | Open in IMG/M |
| 3300019763|Ga0193962_1172039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300020048|Ga0207193_1013376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 11115 | Open in IMG/M |
| 3300021467|Ga0190334_1100367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 793 | Open in IMG/M |
| 3300021486|Ga0190346_1008460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1901 | Open in IMG/M |
| 3300021491|Ga0190332_1051153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 616 | Open in IMG/M |
| 3300021506|Ga0190358_1008761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2149 | Open in IMG/M |
| 3300021506|Ga0190358_1065954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 714 | Open in IMG/M |
| 3300021514|Ga0190293_1067416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1026 | Open in IMG/M |
| 3300021974|Ga0232645_1003969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae | 3781 | Open in IMG/M |
| 3300021974|Ga0232645_1008373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2821 | Open in IMG/M |
| 3300022552|Ga0212118_10114658 | Not Available | 1580 | Open in IMG/M |
| 3300022552|Ga0212118_10536099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300022552|Ga0212118_10604304 | Not Available | 570 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10020690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 1485 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10195537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 501 | Open in IMG/M |
| 3300024423|Ga0190286_1065233 | Not Available | 972 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10485458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 512 | Open in IMG/M |
| 3300025568|Ga0210095_1046292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 1028 | Open in IMG/M |
| 3300025599|Ga0210074_1106162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300025717|Ga0207419_1027338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2157 | Open in IMG/M |
| 3300025793|Ga0210065_1016423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chitinilyticum → Chitinilyticum aquatile | 1381 | Open in IMG/M |
| 3300025895|Ga0209567_10366116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica | 692 | Open in IMG/M |
| 3300026007|Ga0210124_1158356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 716 | Open in IMG/M |
| 3300026352|Ga0210107_1037299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300026546|Ga0256913_10571156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 578 | Open in IMG/M |
| 3300027762|Ga0209288_10015758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 2136 | Open in IMG/M |
| 3300027822|Ga0209633_10074584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2156 | Open in IMG/M |
| 3300027822|Ga0209633_10076432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. EFPC1 | 2121 | Open in IMG/M |
| 3300027828|Ga0209692_10040077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2607 | Open in IMG/M |
| 3300027841|Ga0209262_10226254 | Not Available | 907 | Open in IMG/M |
| 3300027852|Ga0209345_10084730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2118 | Open in IMG/M |
| 3300027852|Ga0209345_10364675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300027978|Ga0209165_10050818 | Not Available | 1473 | Open in IMG/M |
| 3300028029|Ga0256845_1116291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 920 | Open in IMG/M |
| 3300028032|Ga0265296_1014439 | All Organisms → cellular organisms → Bacteria | 4894 | Open in IMG/M |
| 3300028032|Ga0265296_1183779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300028528|Ga0210336_1026203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 563 | Open in IMG/M |
| 3300028601|Ga0265295_1090814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2 | 1564 | Open in IMG/M |
| 3300028601|Ga0265295_1116137 | Not Available | 1269 | Open in IMG/M |
| 3300028920|Ga0272441_10159570 | Not Available | 2090 | Open in IMG/M |
| 3300030493|Ga0310040_1039512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1503 | Open in IMG/M |
| 3300031278|Ga0307431_1111978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_88 | 687 | Open in IMG/M |
| 3300031645|Ga0307990_1132060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1075 | Open in IMG/M |
| 3300031653|Ga0315550_1140685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 976 | Open in IMG/M |
| 3300031741|Ga0307988_1030302 | Not Available | 1625 | Open in IMG/M |
| 3300032272|Ga0316189_10043382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3891 | Open in IMG/M |
| 3300032272|Ga0316189_10729420 | Not Available | 755 | Open in IMG/M |
| 3300032342|Ga0315286_11741435 | Not Available | 588 | Open in IMG/M |
| 3300033407|Ga0214472_10388599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1312 | Open in IMG/M |
| 3300033407|Ga0214472_10745156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina | 886 | Open in IMG/M |
| 3300033528|Ga0316588_1129775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 640 | Open in IMG/M |
| 3300034169|Ga0370480_0117327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfoprunum → Desulfoprunum benzoelyticum | 915 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 8.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 7.65% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 6.47% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 4.71% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 4.71% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 4.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.94% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 2.94% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 2.35% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 2.35% |
| Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 2.35% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.76% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.18% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 1.18% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.18% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.18% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.18% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.18% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.18% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.18% |
| Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment | 1.18% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.18% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.18% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.18% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.59% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.59% |
| Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 0.59% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.59% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.59% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.59% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.59% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.59% |
| Wood Falls | Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls | 0.59% |
| Deep-Sea Worm Associated Microbial Mat | Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Deep-Sea Worm Associated Microbial Mat | 0.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.59% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.59% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.59% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.59% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.59% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.59% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.59% |
| Sediment | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment | 0.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.59% |
| Deep-Sea Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent | 0.59% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.59% |
| Marine Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment | 0.59% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.59% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.59% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.59% |
| Hypersaline Mat | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Mat | 0.59% |
| Hypersaline Mat | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat | 0.59% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.59% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.59% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.59% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.59% |
| Subsea Pool | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool | 0.59% |
| Aquatic | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic | 0.59% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 0.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.59% |
| Tube Worm Surface | Host-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface | 0.59% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.59% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.59% |
| Freshwater | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Freshwater | 0.59% |
| Bioreactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor | 0.59% |
| Aquatic Canal | Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal | 0.59% |
| Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 0.59% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2038011002 | Coalbed microbial communities from New Mexico, USA - 343 | Environmental | Open in IMG/M |
| 2084038021 | Marine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 9-12 cm | Environmental | Open in IMG/M |
| 3300000119 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m | Environmental | Open in IMG/M |
| 3300000120 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000130 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m | Environmental | Open in IMG/M |
| 3300000133 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 02_45m | Environmental | Open in IMG/M |
| 3300000135 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 03_9.5m | Environmental | Open in IMG/M |
| 3300000232 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_64 | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000353 | Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD6A | Environmental | Open in IMG/M |
| 3300001256 | Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MR6A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300001750 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 | Environmental | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002700 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe - PAS_821 | Engineered | Open in IMG/M |
| 3300003154 | Anode biofilm microbial communities from J. Craig Venter Institute, USA, in microbial fuel cells | Engineered | Open in IMG/M |
| 3300003332 | Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1 | Environmental | Open in IMG/M |
| 3300003513 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS828_N3Area_DNA | Environmental | Open in IMG/M |
| 3300003537 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_Marker113_DNA | Environmental | Open in IMG/M |
| 3300003543 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNA | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300005264 | Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4572. Combined assembly of Gp0115316 and Gp0146562 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005753 | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006231 | Marine sediment microbial communities, 2.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC278 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
| 3300007771 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS917_Marker33_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007772 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS914_Anemone_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007776 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS915_Marker113_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008008 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23 | Environmental | Open in IMG/M |
| 3300008340 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10B | Environmental | Open in IMG/M |
| 3300008469 | Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - WM1 | Environmental | Open in IMG/M |
| 3300009033 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MG | Environmental | Open in IMG/M |
| 3300009061 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D2_MG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009379 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 1 cmbsf | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009513 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1Y | Environmental | Open in IMG/M |
| 3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
| 3300009848 | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - F3ET | Environmental | Open in IMG/M |
| 3300009874 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1T | Environmental | Open in IMG/M |
| 3300010228 | Freshwater aquifer microbial community from Bangor, North Wales, UK, enriched with nitrile substrate, replicate 2 | Engineered | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010410 | Aquatic microbial communities from North Sea petroleum storage tank - Cell4b | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010932 | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011255 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, permeate | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013103 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013233 | Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161 | Environmental | Open in IMG/M |
| 3300013293 | Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-13 | Engineered | Open in IMG/M |
| 3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300014257 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014613 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300019757 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_7_MG | Environmental | Open in IMG/M |
| 3300019761 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_6_MG | Environmental | Open in IMG/M |
| 3300019763 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_5_MG | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300021467 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-7-8_MG | Environmental | Open in IMG/M |
| 3300021486 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-4-5_MG | Environmental | Open in IMG/M |
| 3300021491 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-5-6_MG | Environmental | Open in IMG/M |
| 3300021506 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-1-2_MG | Environmental | Open in IMG/M |
| 3300021514 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MG | Environmental | Open in IMG/M |
| 3300021974 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_FS929 _150kmer | Environmental | Open in IMG/M |
| 3300022552 | Guaymas_combined assembly | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300024423 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MG | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025568 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025717 | Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD2A | Environmental | Open in IMG/M |
| 3300025793 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026352 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026546 | Deep-sea worm associated microbial mat communities from Axial Seamount, Juan de Fuca Ridge, Pacific Ocean - Axial_Mat | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027822 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028029 | Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - Riftia | Host-Associated | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028528 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.376 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028601 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilm | Engineered | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300030493 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 (v2) | Engineered | Open in IMG/M |
| 3300031278 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-170 | Environmental | Open in IMG/M |
| 3300031645 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031741 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #183 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Coalbed5_6124000 | 2038011002 | Coalbed Water | LQIGASSDPTGVKPVADEDAATYPRVKLPESDREVGAEGRNM |
| ASA129_01947070 | 2084038021 | Marine Sediment | VAVMDKGFSDEAVVGIKSVADEDAVTYLRVKLPESDSNVGAEGWSMLLRTGISELWLLRVQPSEFSV |
| KGI_S1_ANT01_95mDRAFT_100324862 | 3300000119 | Marine | MDRGSTDEAVVGVKPVADEGAVTHLRVKLSESDKDVGAEGWNM* |
| KGI_S1_ANT01_95mDRAFT_100639632 | 3300000119 | Marine | QPSPKQHRDVFVMDRGSTDEAVVGVKPIADEGVVTHLRIKLLESDKDVGAEGRNM* |
| SA_S2_NOR13_50mDRAFT_10071632 | 3300000120 | Marine | VTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSENDKEVGTEGWNM* |
| SA_S2_NOR13_50mDRAFT_10072791 | 3300000120 | Marine | MDRGFSDEAIVGVKSITDEDAVTYLRIKLSKSDKDVGAEGWNMLHGIEISK* |
| SA_S1_NOR08_45mDRAFT_100331672 | 3300000128 | Marine | VTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSEXDKEVGXEGWNM* |
| SA_S1_NOR08_45mDRAFT_100373991 | 3300000128 | Marine | MDKGFSDETIVGVKLIANEDAVTYLRIKLSESDKEVGAEGWNM* |
| SA_S2_NOR15_50mDRAFT_1000065721 | 3300000130 | Marine | TVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSENDKEVGTEGWNM* |
| SA_S2_NOR15_50mDRAFT_100499142 | 3300000130 | Marine | MDRGSTDEAVVGVKPTADEGVVTYLRVKLSESDRDVGAEGWNM* |
| SA_S2_NOR15_50mDRAFT_100591022 | 3300000130 | Marine | VIVMDRRFSDEAIVGVKLIADDDAVTYPRGKLLESDKEVGAEGRNM* |
| SA_S2_NOR15_50mDRAFT_100852532 | 3300000130 | Marine | MDKGFSDEAIVGVKLIADEDAVTYLRIKLSESDKEVGAEGWNM* |
| SA_S2_NOR15_50mDRAFT_101109792 | 3300000130 | Marine | MDRGSAEEAVVGVKSVADEDAVTYPRVKLPESDKEVGAEGRNM* |
| SA_S1_NOR02_45mDRAFT_10380292 | 3300000133 | Marine | MDKGFSDEAIVGVKLIADEDAVTYLRIKLSENDKEVGTEGWNM* |
| KGI_S1_ANT03_95mDRAFT_10374312 | 3300000135 | Marine | MDRGSTDEAVVGVKPIADEGVVTHLRIKLLESDKDVGAEGRNM* |
| TB_PC08_64DRAFT_10149914 | 3300000232 | Groundwater | VIVMDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM* |
| TDF_OR_ARG05_123mDRAFT_10571821 | 3300000242 | Marine | MDRGSSDEAIVGVKSVANEDAVTYLRVKLSESGSDAGAEGRNMLLRTGISILWLL* |
| ElkS_mat_MD6ADRAFT_10125263 | 3300000353 | Hypersaline Mat | MDRGSSDEAIVGVKPTADDDAVTYRRGKLLESDKEVGAEGRNM* |
| JGI12210J13797_110571251 | 3300001256 | Freshwater | VTVMDRGSAEEAVVGVKPVADEGTVTYLRIKLQESDRDVGAEGRNMLLRTGISE* |
| JGI12210J13797_110571261 | 3300001256 | Freshwater | MDRGSAEEAVVGVKPVADEGTVTYLRIKLQESDRDVGAEGRNMLLRTGISE* |
| JGI24024J18818_101044112 | 3300001685 | Marine | MDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDRDVGAEGRNM* |
| JGI24023J19991_100124002 | 3300001750 | Marine | MDRGSSDEAIVGVKLTASEDAVTYLRIKLSESDMDVGAEGRNK* |
| JGI24023J19991_100393212 | 3300001750 | Marine | MGRGFSDEAIVGVKLSACEGAVTYLRIKLAESDKEVGAEGRNM* |
| JGI24023J19991_100915461 | 3300001750 | Marine | MDRGSTDEAVVGVXSVADEDAVTYLRVKLPESDRDVGXEGRNM* |
| MIS_100469612 | 3300002027 | Sinkhole Freshwater | MDRGSSEEAIVGVKSVADEDAVTCPRVKLPESDKEVGAEGRNM* |
| MIS_101016701 | 3300002027 | Sinkhole Freshwater | MDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM* |
| KVRMV2_1000992456 | 3300002231 | Marine Sediment | MDRGSTDEAVVGVKPVADEDAVTYPRVKLPESDREVGAEGWNM* |
| draft_14382834 | 3300002700 | Hydrocarbon Resource Environments | VTVMDKGFSDEAIVGVKLVANEDAMTYLRIKLPESDKEVGAEGWNM* |
| Ga0052186_101012282 | 3300003154 | Bioreactor | VCVTDRGFSEEAIVGVKTVANEDAVTYQRIKLLESDREVGAEGRNM* |
| GBSed_100322302 | 3300003332 | Marine Hydrothermal Vent Sediment | MDKGFSDETIVGVKLVADEDAVTYLRIKLSESDKEVGAEGWNM* |
| FS828DNA_10069342 | 3300003513 | Diffuse Hydrothermal Flow Volcanic Vent | MDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM* |
| FS903DNA_10841951 | 3300003537 | Diffuse Hydrothermal Flow Volcanic Vent | MDRGSSDEAIVGVKSVANEDSVTYPRVKLSESDKEVGAEGWNM* |
| FS898DNA_100857032 | 3300003543 | Diffuse Hydrothermal Flow Volcanic Vent | QPCPKRDRNVGVMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM* |
| FS898DNA_102661721 | 3300003543 | Diffuse Hydrothermal Flow Volcanic Vent | PCPKRDSDVAVMDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM* |
| Ga0055445_101754421 | 3300004003 | Natural And Restored Wetlands | VTVMGRGSSEEAIVGVKPIADEDAVTYLRVKLSESDREVGAEGRNM* |
| Ga0066603_104833791 | 3300004154 | Freshwater | MDRGSTDEAVVGVKPVADEDAVTYLRRKLPESDREVGAEGWNM* |
| Ga0073581_1092479 | 3300005264 | Sediment | MDRGFSDEAIVGVKPAADEDAVTYQRVKLSENDKDVGAEGRNM* |
| Ga0070728_102735011 | 3300005588 | Marine Sediment | MRQPSPKRYRNVAVMGRGSPEEAIVGAKSVADEDAVTYSRVKLPESDK |
| Ga0070728_106047701 | 3300005588 | Marine Sediment | VTVTDRGSADEAVVGVKPIADEDAVTYLRIKLSESDMDVGAEGWNM* |
| Ga0074649_12264471 | 3300005613 | Saline Water And Sediment | MDRGSSDEAVVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM* |
| Ga0077776_11537062 | 3300005753 | Deep-Sea Hydrothermal Vent | VTVMDKGFSDEAVVGVKSVADEDVVAYLRVKLPESDSNV* |
| Ga0074469_105660812 | 3300005832 | Sediment (Intertidal) | MDRGSSDETIVGVKSVADEDAVTYPRVKLPESDKEVGAEGRNM* |
| Ga0070725_103884452 | 3300005920 | Marine Sediment | VTVTDRGSSDEAKVGVKPVADEDAVTYPRIKLSESDKDVGAEGWNMLLRTGISE* |
| Ga0082391_1240661 | 3300006231 | Marine | MDRGSSDEAIVGVKSVADEDTVTYLRVKLSESGSDAGAEGRNM* |
| Ga0099972_108616142 | 3300006467 | Marine | MDRGSSDEAIVGVKPIADEGVVTHLRVKLSESDKEVGAEGWNM* |
| Ga0099972_118709292 | 3300006467 | Marine | MDRGSSDEAIVGVKPIADDDAVTYLRIKLPESDREVGAEGRNM* |
| Ga0099972_120979071 | 3300006467 | Marine | MDRGSTEEAIVGVKSVADEDAVTYLRVKLPESDKEVGAEGRNM* |
| Ga0099972_120988872 | 3300006467 | Marine | VVVTDRGSTDEAVVGVKPIADEGVVTHLRVKLLESDRDVGAEGWNM* |
| Ga0099972_124667012 | 3300006467 | Marine | MLSIVGVKSVADEDAVTYLRVKLPKSDKEVGAEGRNM* |
| Ga0099972_130830873 | 3300006467 | Marine | MRQPSPKRYRNVAVMGRGSPEEAIVGAKSVADEDAVTYSRVKLPESDKDVGAEGQNM* |
| Ga0099972_135110573 | 3300006467 | Marine | MDRGSSDDAIVGVKLVAGEDTVTYLRVKLPESDMD |
| Ga0102952_10130112 | 3300007769 | Soil | MGRGSSEEAIVGVKPIADEDAVTYLRVKLSESDREVGAEGRNM* |
| Ga0105700_11043101 | 3300007771 | Diffuse Vent Fluid, Hydrothermal Vents | MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM* |
| Ga0105672_11402882 | 3300007772 | Diffuse Vent Fluid, Hydrothermal Vents | MGRGPTDETVVGVKSVADEGAVTYLRVKLPESDREVGAEGWNM* |
| Ga0105674_12227782 | 3300007776 | Diffuse Vent Fluid, Hydrothermal Vents | MDKGFSDEAILGVKLIANEDAVTYLRIKLSESDKEVGAEGWNM* |
| Ga0105711_10045622 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDREVGAEGWNM* |
| Ga0102954_12244481 | 3300007778 | Water | PYPKRGSNVPVMDRGSSDEAIVGVKSVADEDAVTYLRVKLSESGRDAGAEGRNM* |
| Ga0100399_11549292 | 3300008008 | Aquifer | MDRGSSEEAIIGVKSVADDDAVTYLRIKLPESDREVGAEGRNM* |
| Ga0115359_100035802 | 3300008340 | Sediment | MDRGSTDEAIVGVKLVADEDAVTYLRVKLPESDREVGAEGWNM* |
| Ga0115369_100079258 | 3300008469 | Marine Sediment | MDRGFSDEAIVGVKPAADEDAVTYQRIKLLASDSNVGAEGRNM* |
| Ga0102956_12531751 | 3300009033 | Soil | MDRGSAEEAVVGVKPVADEDAETYPRIKLLESDMDVGAEGWNM* |
| Ga0102938_105536721 | 3300009061 | Pond Soil | VFVTDRGSSDEAILGVKLVADEDTVTYLRVKLPESDKEVGAEGRNM |
| Ga0105106_104880202 | 3300009078 | Freshwater Sediment | MDRGSSEEAIVGVKPVADEDAVTYLRAKLPESDREVGAEGRNM* |
| Ga0105047_101282562 | 3300009083 | Freshwater | MDRGSADEAVVGVKPIADEGVVTHLRVKLSESDMEVGAEGWNM* |
| Ga0102812_106730512 | 3300009086 | Estuarine | MDRGSSDEAIVGVKSITDEDTVTYLRIKLSKSDKDVGAEGRNMLHGIGISK* |
| Ga0105107_103411942 | 3300009087 | Freshwater Sediment | MDRGSSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM* |
| Ga0105102_106378431 | 3300009165 | Freshwater Sediment | MDRWFSDEAIVGVKPIADDDAVTYPRGKLLESDREVGAEGRNM* |
| Ga0105100_110028111 | 3300009166 | Freshwater Sediment | MDRGSSEEAIVGVKPAADEDAVTYLRVKLPESDREVGAEGRNM* |
| Ga0118737_10051541 | 3300009379 | Marine Sediment | MDRGPTDEAVVGVKSVADEDAVTYLRVKLPESDREVGA* |
| Ga0118657_102790961 | 3300009506 | Mangrove Sediment | MDRGSSEEAIVGVKPVTDEGAVTYPRGKLLESGKEAGAEGRNM* |
| Ga0129285_101115231 | 3300009513 | Beach Aquifer Porewater | WFSDEAIVGVKPVADEGAVTYLRGKVSERDRDVGAEGWNM* |
| Ga0129287_100328782 | 3300009538 | Beach Aquifer Porewater | MDRGFSDEAIVGVKPAADEDAVTYLRIKLLESDSDVGAEGWNM* |
| Ga0118742_1047463 | 3300009848 | Wood Falls | MDRGSSDEAIVGVKLVASEDTVTCLRVKLPESDMDVGAEGRNM* |
| Ga0131789_100048972 | 3300009874 | Sediment | MDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRNVGAEGWNM* |
| Ga0131789_100846622 | 3300009874 | Sediment | MDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGAEGWNM* |
| Ga0131789_101330431 | 3300009874 | Sediment | MDRGSTDEAVVGVKLVADEDAVTYLRVKLPESDREVGAEGWNM* |
| Ga0136269_10151572 | 3300010228 | Freshwater | VVVTDRGSADEAVVGVKPIAVEDVVTPLRVKLSESDKDVGAEGRNM* |
| Ga0136651_100259121 | 3300010330 | Marine Hydrothermal Vent | MDRGSTDEAVVGVKLVADEDDVTYLRVKLPESDREVGAEGWNM* |
| Ga0136651_100519183 | 3300010330 | Marine Hydrothermal Vent | MDKGFSDEAILGVKLIADEDTVTYLRIKLSESDREVGAEGWNM* |
| Ga0136651_100522452 | 3300010330 | Marine Hydrothermal Vent | MDRGSSDEAIVGVKLTAIEDAVTYLRIKLSESDMDVGAEGRNK* |
| Ga0136651_101273762 | 3300010330 | Marine Hydrothermal Vent | MDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRDVGAEGWNM* |
| Ga0118731_1099173241 | 3300010392 | Marine | PCPKRCRNVTVMDRGSSDEAIVGVKPIADDGVVTHLRVKLSESDKEVGAEGWNM* |
| Ga0118731_1111129492 | 3300010392 | Marine | MDRGSSDEAIVGVKSITDEDAVTYLRIKLSESDKDVGAEGRNMLHGIGISK* |
| Ga0118731_1130405741 | 3300010392 | Marine | MDRGSSDEAIVGVKSVANEDAVTYLRIKLPESDMEVGAEGWNM* |
| Ga0118731_1152343182 | 3300010392 | Marine | MGRWSSDEAIVGVKPIADDDAVTYLRIKLPESDREVGAEGRNM* |
| Ga0136992_100607931 | 3300010410 | Aquatic | AIVGVKPAADEDAVTYPRIKLLESDKDVGAEGWNM* |
| Ga0118733_1005175453 | 3300010430 | Marine Sediment | VVVTDRGPTDEAVVGVKPIADEDVVTHLRVKLLESDRDVGAEGWNM* |
| Ga0118733_1012682282 | 3300010430 | Marine Sediment | VMDRGSSDEAIVGVKPIADDGVVTHLRVKLSESDKEVGAEGWNM* |
| Ga0118733_1045056721 | 3300010430 | Marine Sediment | MDRGSSDEAIVGVKSTTDEDAVTYLRIKLSESDKDVGAEGRNMLHGIGISK* |
| Ga0137843_10039002 | 3300010932 | Subsea Pool | MDRGSTDEAVVGXKPVADEDAVTYPRVKLPESDREVGAEGWNM* |
| Ga0114922_116513181 | 3300011118 | Deep Subsurface | MSQGSADEAIGAVKPAAEEGMVTCLRVKLPESDREVGGK |
| Ga0151667_10040052 | 3300011255 | Marine | MDRGSSDEAIVGVKPVADEDAVTYLRIKLSESGRDAGAEGRNM* |
| Ga0164315_101025132 | 3300013099 | Marine Sediment | MDKGFSDEAIVGVKLIAEEDTVTYPRIKLSESDKEVGAEGWNM* |
| Ga0164315_101790472 | 3300013099 | Marine Sediment | MGRGFSDEAIVGVKLVAIEDTVTYPRIKLLESDREVGAEGWNM* |
| Ga0164315_102032342 | 3300013099 | Marine Sediment | MRNSNVADTDRGSSDEAIVGVKPAADEDAVTYQRVKLQESDKEVGAEGWNM* |
| Ga0164315_104374971 | 3300013099 | Marine Sediment | VTVTDKGFSDEAIVGVKLVADEDTVTYLRIKLPESDKEVGAEGWNM* |
| Ga0164315_108142671 | 3300013099 | Marine Sediment | MDRGSSDEAIVGVKPVANEDAVTYLRIKLLESDREVGAEGWNM* |
| Ga0164315_110785651 | 3300013099 | Marine Sediment | DSNVAVMDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDRDVGAEGWNM* |
| Ga0164313_106533071 | 3300013101 | Marine Sediment | MDRGSTDEVVVGVKSIADEGVVTHLRVKLLESDRDVGA* |
| Ga0164313_107589492 | 3300013101 | Marine Sediment | MDRGSADEAVVGVKSVADEGAVTYLRIKLPESDRDVGAEGWNMLLRTGISE* |
| Ga0164313_110848452 | 3300013101 | Marine Sediment | MDRGSSDEAILGVKLVADDDAVTYLRVKLSESDREVGAEGWNM* |
| Ga0164318_102382662 | 3300013103 | Marine Sediment | VVMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGAEGWNM* |
| Ga0164318_108776661 | 3300013103 | Marine Sediment | CPKRDSNVAVMDRGSSDEAIVGVKSVANEDAVTYPRVKLPESDREVGAEGWNM* |
| Ga0164318_108904872 | 3300013103 | Marine Sediment | MDRGSSDEAIVGVKSVANEDAMTYPRVKLPAIDRDVGAEGWNM* |
| Ga0164318_113976381 | 3300013103 | Marine Sediment | MDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGA |
| Ga0164318_114433492 | 3300013103 | Marine Sediment | MDRGFSDEAIVGVKPAADEDAVTYQRIKLLASDSNVGDQ* |
| Ga0172420_110258651 | 3300013233 | Marine | MDRGSTDEAVVGVKPIADEGVATHPRVKLLESDRDVGA* |
| Ga0120688_10085881 | 3300013293 | Aquatic Canal | MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESGSDAGAEGRNM* |
| Ga0173609_101328152 | 3300013315 | Sediment | MDRGFSEEAIVGVKSVAEEDAVTYPRVKLPESDREVGAEGRNM* |
| Ga0172377_106603582 | 3300014206 | Landfill Leachate | MDRGFSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM* |
| Ga0075319_10265271 | 3300014257 | Natural And Restored Wetlands | MDRGFSEEAIVGVKSVADEDAVTYSRVKLPESDREVGAEGRNM* |
| Ga0075345_11693101 | 3300014312 | Natural And Restored Wetlands | MDRGFSEEAIVGVKPVTDEDAVTYPRVKLLESDREAGAEGRNM* |
| Ga0180008_10717421 | 3300014613 | Groundwater | MTRWSSDEAIVGVKSIADEDTVTYLRVKLSESDKEVGAEG* |
| Ga0164311_104743542 | 3300014914 | Marine Sediment | VMDRGSSDEAIVGVKPVANEDAVTYLRIKLLESDREVGAEGWNM* |
| Ga0180429_102970901 | 3300017960 | Hypersaline Lake Sediment | VTVTDRGSAEEAIVGVKPVADEDAVTYLRVKLSESDKYVGAEGWNMLLRTGISE |
| Ga0193964_10453222 | 3300019757 | Freshwater Microbial Mat | MDRGFSDEAIVGVKPAADEDAVTYQRVKLLESDKDVGAEGRNMELAYGISE |
| Ga0193955_10188911 | 3300019761 | Freshwater Microbial Mat | MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESGSDAGAEGRNM |
| Ga0193962_10499121 | 3300019763 | Freshwater Microbial Mat | MDRWFSDEAIVGVKLAADEDAVTYQRVKLLESDKDVGAEGQNMELA |
| Ga0193962_11720391 | 3300019763 | Freshwater Microbial Mat | MDRGSAEEAVVGVKSVADDDTVTYLRVKLPKSDRDVGAEGRNM |
| Ga0207193_10133762 | 3300020048 | Freshwater Lake Sediment | MDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM |
| Ga0190334_11003672 | 3300021467 | Hydrothermal Vent Sediment | MDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDRDVGAEGRNM |
| Ga0190346_10084603 | 3300021486 | Hydrothermal Vent Microbial Mat | MDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM |
| Ga0190332_10511531 | 3300021491 | Hydrothermal Vent Sediment | MDRGSTDEAVVGVKSVADEDAVTYLRIKLPESDRDVGAEGRNM |
| Ga0190358_10087611 | 3300021506 | Hydrothermal Vent Microbial Mat | MDRGFSDEAIVGVKPAADEDAVTYQRVKLLESDSDVGAEGWNM |
| Ga0190358_10659542 | 3300021506 | Hydrothermal Vent Microbial Mat | AIVGVKVAAVEDAVTYQRVKLPASDKDVGAEGRNM |
| Ga0190293_10674161 | 3300021514 | Hydrothermal Vent Microbial Mat | MDRGSSDEAIVGVKLTAIEDAVTYLRIKLSESDMDVGAEGRNK |
| Ga0232645_10039692 | 3300021974 | Hydrothermal Vent Fluids | VAVMDKGFADEAVVGVKLLADDDAVTYQRIKLTENDREVGAEGWNM |
| Ga0232645_10083732 | 3300021974 | Hydrothermal Vent Fluids | VTVTDKGFSDEAIVGVKLVADEDAVTYLRIKLSASDKEVGAKGWNM |
| Ga0212118_101146581 | 3300022552 | Marine Hydrothermal Vent | MDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRDVGAEGWNM |
| Ga0212118_105360991 | 3300022552 | Marine Hydrothermal Vent | RSPKRSRNVAVMDKGFSDEAILGVKLIADEDTVTYLRIKLSESDREVGAEGWNM |
| Ga0212118_106043042 | 3300022552 | Marine Hydrothermal Vent | MDRGSTDEVVVGVKSIADEGVVTHLRVKLLESDRDVGA |
| (restricted) Ga0233404_100206902 | 3300022913 | Seawater | VTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSESDKEVGAEGWNM |
| (restricted) Ga0233404_101955372 | 3300022913 | Seawater | MDRGFSDEAIVGVKPAADEDAVTYQRIKLLESDMDVGAEGRNMELA |
| Ga0190286_10652332 | 3300024423 | Hydrothermal Vent Microbial Mat | IVGVKPIANEDAVTYPRIKLSESDREVGADRWNMLMAMYPK |
| (restricted) Ga0255045_104854582 | 3300024528 | Seawater | VTVTDRGSADEAVVGVKPIADEDAVTYLRIKLSESDMDVGAEGWNM |
| Ga0210095_10462922 | 3300025568 | Natural And Restored Wetlands | MGRGSSEEAIVGVKPIADEDAVTYLRVKLSESDREVGAEGRNM |
| Ga0210074_11061622 | 3300025599 | Natural And Restored Wetlands | MDRGFSEEAIVGVKSVADEDAVTCLRVKLPESDKEVGAEGRNM |
| Ga0207419_10273382 | 3300025717 | Hypersaline Mat | MDRGSSDEAIVGVKPTADDDAVTYRRGKLLESDKEVGAEGRNM |
| Ga0210065_10164233 | 3300025793 | Natural And Restored Wetlands | VTVMGRGSSEEAIVGVKPIANEDAATYPRVKLSESDKEVGAEGRNM |
| Ga0209567_103661161 | 3300025895 | Pelagic Marine | VTVTDRGSSDEAKVGVKPVADEDAVTYPRIKLSESDKDVGAEGWNML |
| Ga0210124_11583562 | 3300026007 | Natural And Restored Wetlands | RGSSEEAIVGVKPLADEDAVTYLRVKLAASDREVGAEGRNM |
| Ga0210107_10372992 | 3300026352 | Natural And Restored Wetlands | VTVTDRGSSEEAIVGVKPVADEDAVTYPRVKLSESDREVGAEGRHM |
| Ga0256913_105711561 | 3300026546 | Deep-Sea Worm Associated Microbial Mat | MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM |
| Ga0209288_100157583 | 3300027762 | Freshwater Sediment | VIVMDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM |
| Ga0209633_100745841 | 3300027822 | Marine | MDRGSSDEAIVGVKLTASEDAVTYLRIKLSESDMDVGAEGRNK |
| Ga0209633_100764322 | 3300027822 | Marine | MGRGFSDEAIVGVKLSACEGAVTYLRIKLAESDKEVGAEGRNM |
| Ga0209692_100400773 | 3300027828 | Marine Sediment | MDRGSAEEAVVGVKSVADEDAVTYPRVKLPESDKEVGAEGRNM |
| Ga0209262_102262542 | 3300027841 | Freshwater | LRQLSPKRYRNVTVMDRGFSEEAIVGVKPVADEDAVTYPRVKLPESDREVGAEGRNM |
| Ga0209345_100847304 | 3300027852 | Marine | MDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDRDVGAKGRNM |
| Ga0209345_103646752 | 3300027852 | Marine | MDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRKVGAEGWNM |
| Ga0209165_100508181 | 3300027978 | Marine Sediment | VTVTDRGSSDEAKVGVKPVADEDAVTYPRIKLSESDKDVGAEGWNM |
| Ga0256845_11162912 | 3300028029 | Tube Worm Surface | MGRGSSEEAIVGVKLVADEDAVTYPRVKLPESDKDVGAEGWNM |
| Ga0265296_10144394 | 3300028032 | Groundwater | MGRGSSEEAIVGVKPVAEDDAVTYLRVKLSESDREVGAEGRNM |
| Ga0265296_11837792 | 3300028032 | Groundwater | MDRGSSDEAIVGVKPIADDDAVTYPRVKLSVSDREVGAEGRNM |
| Ga0210336_10262031 | 3300028528 | Estuarine | MDRGSSDEAKVGVKLIAEEDAVTYLRVKLSESDKDVGAEGWN |
| Ga0265295_10908142 | 3300028601 | Landfill Leachate | MDRGFSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM |
| Ga0265295_11161372 | 3300028601 | Landfill Leachate | GLSGHSNVCVTGRGSSEEAIVGVKPVANEDAVTYLRVKLPESDREVGAEGRNM |
| Ga0272441_101595702 | 3300028920 | Marine Sediment | VTVMDRGSAEEAVVGVKPVADEDAVTYPRIKLSESDMDVGAEGWNM |
| Ga0310040_10395122 | 3300030493 | Bioremediated Contaminated Groundwater | SDEAIVGVKPAADEDAVTYPRVKLLASDKDVGAEGRNM |
| Ga0307431_11119781 | 3300031278 | Salt Marsh | MGRGSSDEAIVGVKPVADEDTVTYLRVKLLESDREVGAEGRNM |
| Ga0307990_11320602 | 3300031645 | Marine | MDRGFSDEAIVGVKPAADEDAVTYQRVKLLESDSNVGAEGRNM |
| Ga0315550_11406851 | 3300031653 | Salt Marsh Sediment | MDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGAEGWNM |
| Ga0307988_10303021 | 3300031741 | Marine | GVKLVADEGVVTHLRVKLSESDKDVGAEGWNMWHGF |
| Ga0316189_100433824 | 3300032272 | Worm Burrow | MGRGSSEEAIVGVKSVADEDAVTYPRVKLPESDKEVGAEGQNM |
| Ga0316189_107294201 | 3300032272 | Worm Burrow | VIVTDRGSSEEAIVGVKVIAEEGAATYLRIKLSPSDKDVGAEGWNM |
| Ga0315286_117414351 | 3300032342 | Sediment | MDQGSADEAVVAVKSGADEGAAMYLRIKLPESGQEVRGEGWNM |
| Ga0214472_103885992 | 3300033407 | Soil | VVVMDRGSSDEAIVGVKSVAGEDAATYLRIKLPESDKDVGAEGWSM |
| Ga0214472_107451562 | 3300033407 | Soil | VSVTDRGSSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM |
| Ga0316588_11297752 | 3300033528 | Rhizosphere | MDRGSAEEAVVGVKPVADEDTVTYLRIKLQESDRDVGAEGWNVLLRTGISE |
| Ga0370480_0117327_448_579 | 3300034169 | Untreated Peat Soil | MDRGSSEEAIVGVKSVADEDAVTCPRVKLPESDKEVGAEGRNM |
| ⦗Top⦘ |