NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036294

Metagenome / Metatranscriptome Family F036294

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036294
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 45 residues
Representative Sequence MDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDREVGAEGWNM
Number of Associated Samples 118
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.29 %
% of genes near scaffold ends (potentially truncated) 18.24 %
% of genes from short scaffolds (< 2000 bps) 71.76 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment
(8.823 % of family members)
Environment Ontology (ENVO) Unclassified
(22.353 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(22.941 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF08388GIIM 22.94
PF00078RVT_1 12.94
PF04002RadC 0.59
PF07927HicA_toxin 0.59
PF09709Cas_Csd1 0.59
PF01695IstB_IS21 0.59
PF00589Phage_integrase 0.59
PF01269Fibrillarin 0.59
PF01558POR 0.59
PF04986Y2_Tnp 0.59
PF01609DDE_Tnp_1 0.59
PF14319Zn_Tnp_IS91 0.59
PF03480DctP 0.59
PF14539DUF4442 0.59
PF01569PAP2 0.59
PF08546ApbA_C 0.59
PF14366DUF4410 0.59
PF14294DUF4372 0.59
PF00497SBP_bac_3 0.59
PF13470PIN_3 0.59
PF04365BrnT_toxin 0.59
PF12831FAD_oxidored 0.59
PF09957VapB_antitoxin 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.59
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.59
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.59
COG1889Fibrillarin-like rRNA 2'-O-methylase NOP1Translation, ribosomal structure and biogenesis [J] 0.59
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.59
COG2003DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motifReplication, recombination and repair [L] 0.59
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.59
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.59
COG3293TransposaseMobilome: prophages, transposons [X] 0.59
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.59
COG5421TransposaseMobilome: prophages, transposons [X] 0.59
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.59
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.06 %
UnclassifiedrootN/A22.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2038011002|Coalbed1143_GAIGPUK01BLPU8All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
2084038021|ASA129_GJG7ZZE02HFAUJNot Available567Open in IMG/M
3300000119|KGI_S1_ANT01_95mDRAFT_c10032486Not Available2050Open in IMG/M
3300000119|KGI_S1_ANT01_95mDRAFT_c10063963Not Available1221Open in IMG/M
3300000120|SA_S2_NOR13_50mDRAFT_c1007163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol22079Open in IMG/M
3300000120|SA_S2_NOR13_50mDRAFT_c1007279Not Available2055Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10033167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol22075Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10037399Not Available1912Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10000657All Organisms → cellular organisms → Bacteria15233Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10049914Not Available1736Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10059102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1540Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10085253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol21181Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10110979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium969Open in IMG/M
3300000133|SA_S1_NOR02_45mDRAFT_c1038029Not Available554Open in IMG/M
3300000135|KGI_S1_ANT03_95mDRAFT_c1037431Not Available585Open in IMG/M
3300000232|TB_PC08_64DRAFT_1014991Not Available2595Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1057182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina774Open in IMG/M
3300000353|ElkS_mat_MD6ADRAFT_1012526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2098Open in IMG/M
3300001256|JGI12210J13797_11057125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina639Open in IMG/M
3300001256|JGI12210J13797_11057126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina1240Open in IMG/M
3300001685|JGI24024J18818_10104411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina907Open in IMG/M
3300001750|JGI24023J19991_10012400All Organisms → cellular organisms → Bacteria4800Open in IMG/M
3300001750|JGI24023J19991_10039321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. EFPC12052Open in IMG/M
3300001750|JGI24023J19991_10091546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina1007Open in IMG/M
3300002027|MIS_10046961All Organisms → cellular organisms → Bacteria2808Open in IMG/M
3300002027|MIS_10101670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol22041Open in IMG/M
3300002231|KVRMV2_100099245All Organisms → cellular organisms → Bacteria6806Open in IMG/M
3300002700|draft_1438283All Organisms → cellular organisms → Bacteria → Proteobacteria3239Open in IMG/M
3300003154|Ga0052186_10101228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2787Open in IMG/M
3300003332|GBSed_10032230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales2043Open in IMG/M
3300003513|FS828DNA_1006934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300003537|FS903DNA_1084195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina542Open in IMG/M
3300003543|FS898DNA_10085703Not Available1636Open in IMG/M
3300003543|FS898DNA_10266172Not Available1635Open in IMG/M
3300004003|Ga0055445_10175442Not Available726Open in IMG/M
3300004154|Ga0066603_10483379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300005264|Ga0073581_109247All Organisms → cellular organisms → Bacteria → Proteobacteria7297Open in IMG/M
3300005588|Ga0070728_10273501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium921Open in IMG/M
3300005588|Ga0070728_10604770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina567Open in IMG/M
3300005613|Ga0074649_1226447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina552Open in IMG/M
3300005753|Ga0077776_1153706Not Available1134Open in IMG/M
3300005832|Ga0074469_10566081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales650Open in IMG/M
3300005920|Ga0070725_10388445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina621Open in IMG/M
3300006231|Ga0082391_124066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina732Open in IMG/M
3300006467|Ga0099972_10861614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300006467|Ga0099972_11870929All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300006467|Ga0099972_12097907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina500Open in IMG/M
3300006467|Ga0099972_12098887Not Available2159Open in IMG/M
3300006467|Ga0099972_12466701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
3300006467|Ga0099972_13083087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria28340Open in IMG/M
3300006467|Ga0099972_13511057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica606Open in IMG/M
3300007769|Ga0102952_1013011All Organisms → cellular organisms → Bacteria2548Open in IMG/M
3300007771|Ga0105700_1104310Not Available1732Open in IMG/M
3300007772|Ga0105672_1140288Not Available1297Open in IMG/M
3300007776|Ga0105674_1222778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300007777|Ga0105711_1004562Not Available2251Open in IMG/M
3300007778|Ga0102954_1224448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300008008|Ga0100399_1154929All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria946Open in IMG/M
3300008340|Ga0115359_10003580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2296Open in IMG/M
3300008469|Ga0115369_10007925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4482Open in IMG/M
3300009033|Ga0102956_1253175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina597Open in IMG/M
3300009061|Ga0102938_10553672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina580Open in IMG/M
3300009078|Ga0105106_10488020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales886Open in IMG/M
3300009083|Ga0105047_10128256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3091Open in IMG/M
3300009086|Ga0102812_10673051All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina569Open in IMG/M
3300009087|Ga0105107_10341194All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300009165|Ga0105102_10637843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica592Open in IMG/M
3300009166|Ga0105100_11002811All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina523Open in IMG/M
3300009379|Ga0118737_1005154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales2081Open in IMG/M
3300009506|Ga0118657_10279096Not Available2262Open in IMG/M
3300009513|Ga0129285_10111523Not Available1107Open in IMG/M
3300009538|Ga0129287_10032878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2238Open in IMG/M
3300009848|Ga0118742_104746Not Available2132Open in IMG/M
3300009874|Ga0131789_10004897Not Available2404Open in IMG/M
3300009874|Ga0131789_10084662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium836Open in IMG/M
3300009874|Ga0131789_10133043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300010228|Ga0136269_1015157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales836Open in IMG/M
3300010330|Ga0136651_10025912Not Available3212Open in IMG/M
3300010330|Ga0136651_10051918Not Available2206Open in IMG/M
3300010330|Ga0136651_10052245Not Available2197Open in IMG/M
3300010330|Ga0136651_10127376All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300010392|Ga0118731_109917324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300010392|Ga0118731_111112949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium674Open in IMG/M
3300010392|Ga0118731_113040574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina713Open in IMG/M
3300010392|Ga0118731_115234318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1106Open in IMG/M
3300010410|Ga0136992_10060793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2614Open in IMG/M
3300010430|Ga0118733_100517545Not Available2370Open in IMG/M
3300010430|Ga0118733_101268228Not Available1471Open in IMG/M
3300010430|Ga0118733_104505672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium743Open in IMG/M
3300010932|Ga0137843_1003900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales3636Open in IMG/M
3300011118|Ga0114922_11651318Not Available514Open in IMG/M
3300011255|Ga0151667_1004005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300013099|Ga0164315_10102513All Organisms → cellular organisms → Bacteria → Proteobacteria2315Open in IMG/M
3300013099|Ga0164315_10179047Not Available1728Open in IMG/M
3300013099|Ga0164315_10203234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica1616Open in IMG/M
3300013099|Ga0164315_10437497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol21060Open in IMG/M
3300013099|Ga0164315_10814267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300013099|Ga0164315_11078565All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300013101|Ga0164313_10653307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium868Open in IMG/M
3300013101|Ga0164313_10758949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium797Open in IMG/M
3300013101|Ga0164313_11084845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300013103|Ga0164318_10238266All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300013103|Ga0164318_10877666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2745Open in IMG/M
3300013103|Ga0164318_10890487All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina739Open in IMG/M
3300013103|Ga0164318_11397638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina564Open in IMG/M
3300013103|Ga0164318_11443349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → methanotrophic bacterial endosymbiont of Bathymodiolus sp.553Open in IMG/M
3300013233|Ga0172420_11025865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300013293|Ga0120688_1008588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina783Open in IMG/M
3300013315|Ga0173609_10132815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales582Open in IMG/M
3300014206|Ga0172377_10660358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium834Open in IMG/M
3300014257|Ga0075319_1026527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfogranum → Desulfogranum japonicum951Open in IMG/M
3300014312|Ga0075345_1169310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina536Open in IMG/M
3300014613|Ga0180008_1071742Not Available1370Open in IMG/M
3300014914|Ga0164311_10474354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium722Open in IMG/M
3300017960|Ga0180429_10297090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1074Open in IMG/M
3300019757|Ga0193964_1045322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1014Open in IMG/M
3300019761|Ga0193955_1018891All Organisms → cellular organisms → Bacteria → Proteobacteria2231Open in IMG/M
3300019763|Ga0193962_1049912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina1106Open in IMG/M
3300019763|Ga0193962_1172039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300020048|Ga0207193_1013376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria11115Open in IMG/M
3300021467|Ga0190334_1100367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina793Open in IMG/M
3300021486|Ga0190346_1008460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1901Open in IMG/M
3300021491|Ga0190332_1051153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina616Open in IMG/M
3300021506|Ga0190358_1008761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2149Open in IMG/M
3300021506|Ga0190358_1065954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae714Open in IMG/M
3300021514|Ga0190293_1067416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1026Open in IMG/M
3300021974|Ga0232645_1003969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae3781Open in IMG/M
3300021974|Ga0232645_1008373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2821Open in IMG/M
3300022552|Ga0212118_10114658Not Available1580Open in IMG/M
3300022552|Ga0212118_10536099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300022552|Ga0212118_10604304Not Available570Open in IMG/M
(restricted) 3300022913|Ga0233404_10020690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol21485Open in IMG/M
(restricted) 3300022913|Ga0233404_10195537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina501Open in IMG/M
3300024423|Ga0190286_1065233Not Available972Open in IMG/M
(restricted) 3300024528|Ga0255045_10485458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina512Open in IMG/M
3300025568|Ga0210095_1046292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol21028Open in IMG/M
3300025599|Ga0210074_1106162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300025717|Ga0207419_1027338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2157Open in IMG/M
3300025793|Ga0210065_1016423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chitinilyticum → Chitinilyticum aquatile1381Open in IMG/M
3300025895|Ga0209567_10366116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Thermodesulforhabdus → Thermodesulforhabdus norvegica692Open in IMG/M
3300026007|Ga0210124_1158356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol2716Open in IMG/M
3300026352|Ga0210107_1037299All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300026546|Ga0256913_10571156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina578Open in IMG/M
3300027762|Ga0209288_10015758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol22136Open in IMG/M
3300027822|Ga0209633_10074584All Organisms → cellular organisms → Bacteria → Proteobacteria2156Open in IMG/M
3300027822|Ga0209633_10076432All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. EFPC12121Open in IMG/M
3300027828|Ga0209692_10040077All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales2607Open in IMG/M
3300027841|Ga0209262_10226254Not Available907Open in IMG/M
3300027852|Ga0209345_10084730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2118Open in IMG/M
3300027852|Ga0209345_10364675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium859Open in IMG/M
3300027978|Ga0209165_10050818Not Available1473Open in IMG/M
3300028029|Ga0256845_1116291All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria920Open in IMG/M
3300028032|Ga0265296_1014439All Organisms → cellular organisms → Bacteria4894Open in IMG/M
3300028032|Ga0265296_1183779All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300028528|Ga0210336_1026203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina563Open in IMG/M
3300028601|Ga0265295_1090814All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacula → Desulfobacula toluolica → Desulfobacula toluolica Tol21564Open in IMG/M
3300028601|Ga0265295_1116137Not Available1269Open in IMG/M
3300028920|Ga0272441_10159570Not Available2090Open in IMG/M
3300030493|Ga0310040_1039512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae1503Open in IMG/M
3300031278|Ga0307431_1111978All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_88687Open in IMG/M
3300031645|Ga0307990_1132060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1075Open in IMG/M
3300031653|Ga0315550_1140685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales976Open in IMG/M
3300031741|Ga0307988_1030302Not Available1625Open in IMG/M
3300032272|Ga0316189_10043382All Organisms → cellular organisms → Bacteria → Proteobacteria3891Open in IMG/M
3300032272|Ga0316189_10729420Not Available755Open in IMG/M
3300032342|Ga0315286_11741435Not Available588Open in IMG/M
3300033407|Ga0214472_10388599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1312Open in IMG/M
3300033407|Ga0214472_10745156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina886Open in IMG/M
3300033528|Ga0316588_1129775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria640Open in IMG/M
3300034169|Ga0370480_0117327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfoprunum → Desulfoprunum benzoelyticum915Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment8.82%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine7.65%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine6.47%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment4.71%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine4.71%
Marine Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent4.12%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.94%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat2.94%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat2.35%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent2.35%
Diffuse Vent Fluid, Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents2.35%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.76%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate1.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.18%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater1.18%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.18%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.18%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.18%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.18%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.18%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.18%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids1.18%
Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment1.18%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.18%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater1.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.18%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.18%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.18%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.59%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.59%
Coalbed WaterEnvironmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water0.59%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.59%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.59%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater0.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.59%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.59%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.59%
Wood FallsEnvironmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls0.59%
Deep-Sea Worm Associated Microbial MatEnvironmental → Aquatic → Marine → Oceanic → Microbial Mats → Deep-Sea Worm Associated Microbial Mat0.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.59%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.59%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.59%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.59%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.59%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.59%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.59%
SedimentEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Sediment0.59%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.59%
Deep-Sea Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent0.59%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.59%
Marine Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment0.59%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.59%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.59%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.59%
Hypersaline MatEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Mat0.59%
Hypersaline MatEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat0.59%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.59%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.59%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.59%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.59%
Subsea PoolEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool0.59%
AquaticEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic0.59%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.59%
Pond SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil0.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.59%
Tube Worm SurfaceHost-Associated → Annelida → Integument → Unclassified → Unclassified → Tube Worm Surface0.59%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.59%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.59%
FreshwaterEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Freshwater0.59%
BioreactorEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor0.59%
Aquatic CanalEngineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal0.59%
Bioremediated Contaminated GroundwaterEngineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater0.59%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2038011002Coalbed microbial communities from New Mexico, USA - 343EnvironmentalOpen in IMG/M
2084038021Marine sediment archaeal communities from Santa Barbara Basin, CA, that are methane-oxidizing, sample 9-12 cmEnvironmentalOpen in IMG/M
3300000119Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5mEnvironmentalOpen in IMG/M
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000133Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 02_45mEnvironmentalOpen in IMG/M
3300000135Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 03_9.5mEnvironmentalOpen in IMG/M
3300000232Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_64EnvironmentalOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300000353Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD6AEnvironmentalOpen in IMG/M
3300001256Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MR6A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300001685Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2EnvironmentalOpen in IMG/M
3300001750Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1EnvironmentalOpen in IMG/M
3300002027Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5kEnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002700Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe - PAS_821EngineeredOpen in IMG/M
3300003154Anode biofilm microbial communities from J. Craig Venter Institute, USA, in microbial fuel cellsEngineeredOpen in IMG/M
3300003332Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1EnvironmentalOpen in IMG/M
3300003513Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS828_N3Area_DNAEnvironmentalOpen in IMG/M
3300003537Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_Marker113_DNAEnvironmentalOpen in IMG/M
3300003543Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNAEnvironmentalOpen in IMG/M
3300004003Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1EnvironmentalOpen in IMG/M
3300004154Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8EnvironmentalOpen in IMG/M
3300005264Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4572. Combined assembly of Gp0115316 and Gp0146562EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300005753Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assemblyEnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006231Marine sediment microbial communities, 2.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC278EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007769Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MGEnvironmentalOpen in IMG/M
3300007771Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS917_Marker33_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007772Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS914_Anemone_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007776Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS915_Marker113_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007777Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300008008Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23EnvironmentalOpen in IMG/M
3300008340Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10BEnvironmentalOpen in IMG/M
3300008469Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - WM1EnvironmentalOpen in IMG/M
3300009033Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MGEnvironmentalOpen in IMG/M
3300009061Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_B_D2_MGEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009379Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 1 cmbsfEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009513Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1YEnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009848Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - F3ETEnvironmentalOpen in IMG/M
3300009874Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1TEnvironmentalOpen in IMG/M
3300010228Freshwater aquifer microbial community from Bangor, North Wales, UK, enriched with nitrile substrate, replicate 2EngineeredOpen in IMG/M
3300010330Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010410Aquatic microbial communities from North Sea petroleum storage tank - Cell4bEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010932Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011255Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, permeateEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013103Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013233Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161EnvironmentalOpen in IMG/M
3300013293Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-13EngineeredOpen in IMG/M
3300013315Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1BEngineeredOpen in IMG/M
3300014206Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaGEngineeredOpen in IMG/M
3300014257Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1EnvironmentalOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014613Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaGEnvironmentalOpen in IMG/M
3300014914Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cmEnvironmentalOpen in IMG/M
3300017960Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaGEnvironmentalOpen in IMG/M
3300019757Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_7_MGEnvironmentalOpen in IMG/M
3300019761Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_6_MGEnvironmentalOpen in IMG/M
3300019763Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_5_MGEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300021467Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-7-8_MGEnvironmentalOpen in IMG/M
3300021486Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-4-5_MGEnvironmentalOpen in IMG/M
3300021491Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-5-6_MGEnvironmentalOpen in IMG/M
3300021506Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-1-2_MGEnvironmentalOpen in IMG/M
3300021514Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MGEnvironmentalOpen in IMG/M
3300021974Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_FS929 _150kmerEnvironmentalOpen in IMG/M
3300022552Guaymas_combined assemblyEnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300024423Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MGEnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025568Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025599Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025717Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD2AEnvironmentalOpen in IMG/M
3300025793Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025895Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)EnvironmentalOpen in IMG/M
3300026007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026352Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026546Deep-sea worm associated microbial mat communities from Axial Seamount, Juan de Fuca Ridge, Pacific Ocean - Axial_MatEnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027822Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300028029Tube worm associated microbial communities from hydrothermal vent at the East Pacific Rise, Pacific Ocean - RiftiaHost-AssociatedOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300028528Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.376 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028601Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilmEngineeredOpen in IMG/M
3300028920Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6NEnvironmentalOpen in IMG/M
3300030493Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 (v2)EngineeredOpen in IMG/M
3300031278Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-170EnvironmentalOpen in IMG/M
3300031645Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031653Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90EnvironmentalOpen in IMG/M
3300031741Marine microbial communities from Ellis Fjord, Antarctic Ocean - #183EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033528Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Coalbed5_61240002038011002Coalbed WaterLQIGASSDPTGVKPVADEDAATYPRVKLPESDREVGAEGRNM
ASA129_019470702084038021Marine SedimentVAVMDKGFSDEAVVGIKSVADEDAVTYLRVKLPESDSNVGAEGWSMLLRTGISELWLLRVQPSEFSV
KGI_S1_ANT01_95mDRAFT_1003248623300000119MarineMDRGSTDEAVVGVKPVADEGAVTHLRVKLSESDKDVGAEGWNM*
KGI_S1_ANT01_95mDRAFT_1006396323300000119MarineQPSPKQHRDVFVMDRGSTDEAVVGVKPIADEGVVTHLRIKLLESDKDVGAEGRNM*
SA_S2_NOR13_50mDRAFT_100716323300000120MarineVTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSENDKEVGTEGWNM*
SA_S2_NOR13_50mDRAFT_100727913300000120MarineMDRGFSDEAIVGVKSITDEDAVTYLRIKLSKSDKDVGAEGWNMLHGIEISK*
SA_S1_NOR08_45mDRAFT_1003316723300000128MarineVTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSEXDKEVGXEGWNM*
SA_S1_NOR08_45mDRAFT_1003739913300000128MarineMDKGFSDETIVGVKLIANEDAVTYLRIKLSESDKEVGAEGWNM*
SA_S2_NOR15_50mDRAFT_10000657213300000130MarineTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSENDKEVGTEGWNM*
SA_S2_NOR15_50mDRAFT_1004991423300000130MarineMDRGSTDEAVVGVKPTADEGVVTYLRVKLSESDRDVGAEGWNM*
SA_S2_NOR15_50mDRAFT_1005910223300000130MarineVIVMDRRFSDEAIVGVKLIADDDAVTYPRGKLLESDKEVGAEGRNM*
SA_S2_NOR15_50mDRAFT_1008525323300000130MarineMDKGFSDEAIVGVKLIADEDAVTYLRIKLSESDKEVGAEGWNM*
SA_S2_NOR15_50mDRAFT_1011097923300000130MarineMDRGSAEEAVVGVKSVADEDAVTYPRVKLPESDKEVGAEGRNM*
SA_S1_NOR02_45mDRAFT_103802923300000133MarineMDKGFSDEAIVGVKLIADEDAVTYLRIKLSENDKEVGTEGWNM*
KGI_S1_ANT03_95mDRAFT_103743123300000135MarineMDRGSTDEAVVGVKPIADEGVVTHLRIKLLESDKDVGAEGRNM*
TB_PC08_64DRAFT_101499143300000232GroundwaterVIVMDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM*
TDF_OR_ARG05_123mDRAFT_105718213300000242MarineMDRGSSDEAIVGVKSVANEDAVTYLRVKLSESGSDAGAEGRNMLLRTGISILWLL*
ElkS_mat_MD6ADRAFT_101252633300000353Hypersaline MatMDRGSSDEAIVGVKPTADDDAVTYRRGKLLESDKEVGAEGRNM*
JGI12210J13797_1105712513300001256FreshwaterVTVMDRGSAEEAVVGVKPVADEGTVTYLRIKLQESDRDVGAEGRNMLLRTGISE*
JGI12210J13797_1105712613300001256FreshwaterMDRGSAEEAVVGVKPVADEGTVTYLRIKLQESDRDVGAEGRNMLLRTGISE*
JGI24024J18818_1010441123300001685MarineMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDRDVGAEGRNM*
JGI24023J19991_1001240023300001750MarineMDRGSSDEAIVGVKLTASEDAVTYLRIKLSESDMDVGAEGRNK*
JGI24023J19991_1003932123300001750MarineMGRGFSDEAIVGVKLSACEGAVTYLRIKLAESDKEVGAEGRNM*
JGI24023J19991_1009154613300001750MarineMDRGSTDEAVVGVXSVADEDAVTYLRVKLPESDRDVGXEGRNM*
MIS_1004696123300002027Sinkhole FreshwaterMDRGSSEEAIVGVKSVADEDAVTCPRVKLPESDKEVGAEGRNM*
MIS_1010167013300002027Sinkhole FreshwaterMDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM*
KVRMV2_10009924563300002231Marine SedimentMDRGSTDEAVVGVKPVADEDAVTYPRVKLPESDREVGAEGWNM*
draft_143828343300002700Hydrocarbon Resource EnvironmentsVTVMDKGFSDEAIVGVKLVANEDAMTYLRIKLPESDKEVGAEGWNM*
Ga0052186_1010122823300003154BioreactorVCVTDRGFSEEAIVGVKTVANEDAVTYQRIKLLESDREVGAEGRNM*
GBSed_1003223023300003332Marine Hydrothermal Vent SedimentMDKGFSDETIVGVKLVADEDAVTYLRIKLSESDKEVGAEGWNM*
FS828DNA_100693423300003513Diffuse Hydrothermal Flow Volcanic VentMDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM*
FS903DNA_108419513300003537Diffuse Hydrothermal Flow Volcanic VentMDRGSSDEAIVGVKSVANEDSVTYPRVKLSESDKEVGAEGWNM*
FS898DNA_1008570323300003543Diffuse Hydrothermal Flow Volcanic VentQPCPKRDRNVGVMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM*
FS898DNA_1026617213300003543Diffuse Hydrothermal Flow Volcanic VentPCPKRDSDVAVMDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM*
Ga0055445_1017544213300004003Natural And Restored WetlandsVTVMGRGSSEEAIVGVKPIADEDAVTYLRVKLSESDREVGAEGRNM*
Ga0066603_1048337913300004154FreshwaterMDRGSTDEAVVGVKPVADEDAVTYLRRKLPESDREVGAEGWNM*
Ga0073581_10924793300005264SedimentMDRGFSDEAIVGVKPAADEDAVTYQRVKLSENDKDVGAEGRNM*
Ga0070728_1027350113300005588Marine SedimentMRQPSPKRYRNVAVMGRGSPEEAIVGAKSVADEDAVTYSRVKLPESDK
Ga0070728_1060477013300005588Marine SedimentVTVTDRGSADEAVVGVKPIADEDAVTYLRIKLSESDMDVGAEGWNM*
Ga0074649_122644713300005613Saline Water And SedimentMDRGSSDEAVVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM*
Ga0077776_115370623300005753Deep-Sea Hydrothermal VentVTVMDKGFSDEAVVGVKSVADEDVVAYLRVKLPESDSNV*
Ga0074469_1056608123300005832Sediment (Intertidal)MDRGSSDETIVGVKSVADEDAVTYPRVKLPESDKEVGAEGRNM*
Ga0070725_1038844523300005920Marine SedimentVTVTDRGSSDEAKVGVKPVADEDAVTYPRIKLSESDKDVGAEGWNMLLRTGISE*
Ga0082391_12406613300006231MarineMDRGSSDEAIVGVKSVADEDTVTYLRVKLSESGSDAGAEGRNM*
Ga0099972_1086161423300006467MarineMDRGSSDEAIVGVKPIADEGVVTHLRVKLSESDKEVGAEGWNM*
Ga0099972_1187092923300006467MarineMDRGSSDEAIVGVKPIADDDAVTYLRIKLPESDREVGAEGRNM*
Ga0099972_1209790713300006467MarineMDRGSTEEAIVGVKSVADEDAVTYLRVKLPESDKEVGAEGRNM*
Ga0099972_1209888723300006467MarineVVVTDRGSTDEAVVGVKPIADEGVVTHLRVKLLESDRDVGAEGWNM*
Ga0099972_1246670123300006467MarineMLSIVGVKSVADEDAVTYLRVKLPKSDKEVGAEGRNM*
Ga0099972_1308308733300006467MarineMRQPSPKRYRNVAVMGRGSPEEAIVGAKSVADEDAVTYSRVKLPESDKDVGAEGQNM*
Ga0099972_1351105733300006467MarineMDRGSSDDAIVGVKLVAGEDTVTYLRVKLPESDMD
Ga0102952_101301123300007769SoilMGRGSSEEAIVGVKPIADEDAVTYLRVKLSESDREVGAEGRNM*
Ga0105700_110431013300007771Diffuse Vent Fluid, Hydrothermal VentsMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM*
Ga0105672_114028823300007772Diffuse Vent Fluid, Hydrothermal VentsMGRGPTDETVVGVKSVADEGAVTYLRVKLPESDREVGAEGWNM*
Ga0105674_122277823300007776Diffuse Vent Fluid, Hydrothermal VentsMDKGFSDEAILGVKLIANEDAVTYLRIKLSESDKEVGAEGWNM*
Ga0105711_100456223300007777Diffuse Vent Fluid, Hydrothermal VentsMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDREVGAEGWNM*
Ga0102954_122444813300007778WaterPYPKRGSNVPVMDRGSSDEAIVGVKSVADEDAVTYLRVKLSESGRDAGAEGRNM*
Ga0100399_115492923300008008AquiferMDRGSSEEAIIGVKSVADDDAVTYLRIKLPESDREVGAEGRNM*
Ga0115359_1000358023300008340SedimentMDRGSTDEAIVGVKLVADEDAVTYLRVKLPESDREVGAEGWNM*
Ga0115369_1000792583300008469Marine SedimentMDRGFSDEAIVGVKPAADEDAVTYQRIKLLASDSNVGAEGRNM*
Ga0102956_125317513300009033SoilMDRGSAEEAVVGVKPVADEDAETYPRIKLLESDMDVGAEGWNM*
Ga0102938_1055367213300009061Pond SoilVFVTDRGSSDEAILGVKLVADEDTVTYLRVKLPESDKEVGAEGRNM
Ga0105106_1048802023300009078Freshwater SedimentMDRGSSEEAIVGVKPVADEDAVTYLRAKLPESDREVGAEGRNM*
Ga0105047_1012825623300009083FreshwaterMDRGSADEAVVGVKPIADEGVVTHLRVKLSESDMEVGAEGWNM*
Ga0102812_1067305123300009086EstuarineMDRGSSDEAIVGVKSITDEDTVTYLRIKLSKSDKDVGAEGRNMLHGIGISK*
Ga0105107_1034119423300009087Freshwater SedimentMDRGSSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM*
Ga0105102_1063784313300009165Freshwater SedimentMDRWFSDEAIVGVKPIADDDAVTYPRGKLLESDREVGAEGRNM*
Ga0105100_1100281113300009166Freshwater SedimentMDRGSSEEAIVGVKPAADEDAVTYLRVKLPESDREVGAEGRNM*
Ga0118737_100515413300009379Marine SedimentMDRGPTDEAVVGVKSVADEDAVTYLRVKLPESDREVGA*
Ga0118657_1027909613300009506Mangrove SedimentMDRGSSEEAIVGVKPVTDEGAVTYPRGKLLESGKEAGAEGRNM*
Ga0129285_1011152313300009513Beach Aquifer PorewaterWFSDEAIVGVKPVADEGAVTYLRGKVSERDRDVGAEGWNM*
Ga0129287_1003287823300009538Beach Aquifer PorewaterMDRGFSDEAIVGVKPAADEDAVTYLRIKLLESDSDVGAEGWNM*
Ga0118742_10474633300009848Wood FallsMDRGSSDEAIVGVKLVASEDTVTCLRVKLPESDMDVGAEGRNM*
Ga0131789_1000489723300009874SedimentMDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRNVGAEGWNM*
Ga0131789_1008466223300009874SedimentMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGAEGWNM*
Ga0131789_1013304313300009874SedimentMDRGSTDEAVVGVKLVADEDAVTYLRVKLPESDREVGAEGWNM*
Ga0136269_101515723300010228FreshwaterVVVTDRGSADEAVVGVKPIAVEDVVTPLRVKLSESDKDVGAEGRNM*
Ga0136651_1002591213300010330Marine Hydrothermal VentMDRGSTDEAVVGVKLVADEDDVTYLRVKLPESDREVGAEGWNM*
Ga0136651_1005191833300010330Marine Hydrothermal VentMDKGFSDEAILGVKLIADEDTVTYLRIKLSESDREVGAEGWNM*
Ga0136651_1005224523300010330Marine Hydrothermal VentMDRGSSDEAIVGVKLTAIEDAVTYLRIKLSESDMDVGAEGRNK*
Ga0136651_1012737623300010330Marine Hydrothermal VentMDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRDVGAEGWNM*
Ga0118731_10991732413300010392MarinePCPKRCRNVTVMDRGSSDEAIVGVKPIADDGVVTHLRVKLSESDKEVGAEGWNM*
Ga0118731_11111294923300010392MarineMDRGSSDEAIVGVKSITDEDAVTYLRIKLSESDKDVGAEGRNMLHGIGISK*
Ga0118731_11304057413300010392MarineMDRGSSDEAIVGVKSVANEDAVTYLRIKLPESDMEVGAEGWNM*
Ga0118731_11523431823300010392MarineMGRWSSDEAIVGVKPIADDDAVTYLRIKLPESDREVGAEGRNM*
Ga0136992_1006079313300010410AquaticAIVGVKPAADEDAVTYPRIKLLESDKDVGAEGWNM*
Ga0118733_10051754533300010430Marine SedimentVVVTDRGPTDEAVVGVKPIADEDVVTHLRVKLLESDRDVGAEGWNM*
Ga0118733_10126822823300010430Marine SedimentVMDRGSSDEAIVGVKPIADDGVVTHLRVKLSESDKEVGAEGWNM*
Ga0118733_10450567213300010430Marine SedimentMDRGSSDEAIVGVKSTTDEDAVTYLRIKLSESDKDVGAEGRNMLHGIGISK*
Ga0137843_100390023300010932Subsea PoolMDRGSTDEAVVGXKPVADEDAVTYPRVKLPESDREVGAEGWNM*
Ga0114922_1165131813300011118Deep SubsurfaceMSQGSADEAIGAVKPAAEEGMVTCLRVKLPESDREVGGK
Ga0151667_100400523300011255MarineMDRGSSDEAIVGVKPVADEDAVTYLRIKLSESGRDAGAEGRNM*
Ga0164315_1010251323300013099Marine SedimentMDKGFSDEAIVGVKLIAEEDTVTYPRIKLSESDKEVGAEGWNM*
Ga0164315_1017904723300013099Marine SedimentMGRGFSDEAIVGVKLVAIEDTVTYPRIKLLESDREVGAEGWNM*
Ga0164315_1020323423300013099Marine SedimentMRNSNVADTDRGSSDEAIVGVKPAADEDAVTYQRVKLQESDKEVGAEGWNM*
Ga0164315_1043749713300013099Marine SedimentVTVTDKGFSDEAIVGVKLVADEDTVTYLRIKLPESDKEVGAEGWNM*
Ga0164315_1081426713300013099Marine SedimentMDRGSSDEAIVGVKPVANEDAVTYLRIKLLESDREVGAEGWNM*
Ga0164315_1107856513300013099Marine SedimentDSNVAVMDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDRDVGAEGWNM*
Ga0164313_1065330713300013101Marine SedimentMDRGSTDEVVVGVKSIADEGVVTHLRVKLLESDRDVGA*
Ga0164313_1075894923300013101Marine SedimentMDRGSADEAVVGVKSVADEGAVTYLRIKLPESDRDVGAEGWNMLLRTGISE*
Ga0164313_1108484523300013101Marine SedimentMDRGSSDEAILGVKLVADDDAVTYLRVKLSESDREVGAEGWNM*
Ga0164318_1023826623300013103Marine SedimentVVMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGAEGWNM*
Ga0164318_1087766613300013103Marine SedimentCPKRDSNVAVMDRGSSDEAIVGVKSVANEDAVTYPRVKLPESDREVGAEGWNM*
Ga0164318_1089048723300013103Marine SedimentMDRGSSDEAIVGVKSVANEDAMTYPRVKLPAIDRDVGAEGWNM*
Ga0164318_1139763813300013103Marine SedimentMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGA
Ga0164318_1144334923300013103Marine SedimentMDRGFSDEAIVGVKPAADEDAVTYQRIKLLASDSNVGDQ*
Ga0172420_1102586513300013233MarineMDRGSTDEAVVGVKPIADEGVATHPRVKLLESDRDVGA*
Ga0120688_100858813300013293Aquatic CanalMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESGSDAGAEGRNM*
Ga0173609_1013281523300013315SedimentMDRGFSEEAIVGVKSVAEEDAVTYPRVKLPESDREVGAEGRNM*
Ga0172377_1066035823300014206Landfill LeachateMDRGFSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM*
Ga0075319_102652713300014257Natural And Restored WetlandsMDRGFSEEAIVGVKSVADEDAVTYSRVKLPESDREVGAEGRNM*
Ga0075345_116931013300014312Natural And Restored WetlandsMDRGFSEEAIVGVKPVTDEDAVTYPRVKLLESDREAGAEGRNM*
Ga0180008_107174213300014613GroundwaterMTRWSSDEAIVGVKSIADEDTVTYLRVKLSESDKEVGAEG*
Ga0164311_1047435423300014914Marine SedimentVMDRGSSDEAIVGVKPVANEDAVTYLRIKLLESDREVGAEGWNM*
Ga0180429_1029709013300017960Hypersaline Lake SedimentVTVTDRGSAEEAIVGVKPVADEDAVTYLRVKLSESDKYVGAEGWNMLLRTGISE
Ga0193964_104532223300019757Freshwater Microbial MatMDRGFSDEAIVGVKPAADEDAVTYQRVKLLESDKDVGAEGRNMELAYGISE
Ga0193955_101889113300019761Freshwater Microbial MatMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESGSDAGAEGRNM
Ga0193962_104991213300019763Freshwater Microbial MatMDRWFSDEAIVGVKLAADEDAVTYQRVKLLESDKDVGAEGQNMELA
Ga0193962_117203913300019763Freshwater Microbial MatMDRGSAEEAVVGVKSVADDDTVTYLRVKLPKSDRDVGAEGRNM
Ga0207193_101337623300020048Freshwater Lake SedimentMDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM
Ga0190334_110036723300021467Hydrothermal Vent SedimentMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDRDVGAEGRNM
Ga0190346_100846033300021486Hydrothermal Vent Microbial MatMDRGSSDEAIVGVKSVANEDAVTYPRVKLPASDREVGAEGWNM
Ga0190332_105115313300021491Hydrothermal Vent SedimentMDRGSTDEAVVGVKSVADEDAVTYLRIKLPESDRDVGAEGRNM
Ga0190358_100876113300021506Hydrothermal Vent Microbial MatMDRGFSDEAIVGVKPAADEDAVTYQRVKLLESDSDVGAEGWNM
Ga0190358_106595423300021506Hydrothermal Vent Microbial MatAIVGVKVAAVEDAVTYQRVKLPASDKDVGAEGRNM
Ga0190293_106741613300021514Hydrothermal Vent Microbial MatMDRGSSDEAIVGVKLTAIEDAVTYLRIKLSESDMDVGAEGRNK
Ga0232645_100396923300021974Hydrothermal Vent FluidsVAVMDKGFADEAVVGVKLLADDDAVTYQRIKLTENDREVGAEGWNM
Ga0232645_100837323300021974Hydrothermal Vent FluidsVTVTDKGFSDEAIVGVKLVADEDAVTYLRIKLSASDKEVGAKGWNM
Ga0212118_1011465813300022552Marine Hydrothermal VentMDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRDVGAEGWNM
Ga0212118_1053609913300022552Marine Hydrothermal VentRSPKRSRNVAVMDKGFSDEAILGVKLIADEDTVTYLRIKLSESDREVGAEGWNM
Ga0212118_1060430423300022552Marine Hydrothermal VentMDRGSTDEVVVGVKSIADEGVVTHLRVKLLESDRDVGA
(restricted) Ga0233404_1002069023300022913SeawaterVTVMDKGFSDEAIVGVKLIADEDAVTYLRIKLSESDKEVGAEGWNM
(restricted) Ga0233404_1019553723300022913SeawaterMDRGFSDEAIVGVKPAADEDAVTYQRIKLLESDMDVGAEGRNMELA
Ga0190286_106523323300024423Hydrothermal Vent Microbial MatIVGVKPIANEDAVTYPRIKLSESDREVGADRWNMLMAMYPK
(restricted) Ga0255045_1048545823300024528SeawaterVTVTDRGSADEAVVGVKPIADEDAVTYLRIKLSESDMDVGAEGWNM
Ga0210095_104629223300025568Natural And Restored WetlandsMGRGSSEEAIVGVKPIADEDAVTYLRVKLSESDREVGAEGRNM
Ga0210074_110616223300025599Natural And Restored WetlandsMDRGFSEEAIVGVKSVADEDAVTCLRVKLPESDKEVGAEGRNM
Ga0207419_102733823300025717Hypersaline MatMDRGSSDEAIVGVKPTADDDAVTYRRGKLLESDKEVGAEGRNM
Ga0210065_101642333300025793Natural And Restored WetlandsVTVMGRGSSEEAIVGVKPIANEDAATYPRVKLSESDKEVGAEGRNM
Ga0209567_1036611613300025895Pelagic MarineVTVTDRGSSDEAKVGVKPVADEDAVTYPRIKLSESDKDVGAEGWNML
Ga0210124_115835623300026007Natural And Restored WetlandsRGSSEEAIVGVKPLADEDAVTYLRVKLAASDREVGAEGRNM
Ga0210107_103729923300026352Natural And Restored WetlandsVTVTDRGSSEEAIVGVKPVADEDAVTYPRVKLSESDREVGAEGRHM
Ga0256913_1057115613300026546Deep-Sea Worm Associated Microbial MatMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM
Ga0209288_1001575833300027762Freshwater SedimentVIVMDRGSSEEAIVGVKLVADDDAVRYLRIKLLESDREVGAEGRNM
Ga0209633_1007458413300027822MarineMDRGSSDEAIVGVKLTASEDAVTYLRIKLSESDMDVGAEGRNK
Ga0209633_1007643223300027822MarineMGRGFSDEAIVGVKLSACEGAVTYLRIKLAESDKEVGAEGRNM
Ga0209692_1004007733300027828Marine SedimentMDRGSAEEAVVGVKSVADEDAVTYPRVKLPESDKEVGAEGRNM
Ga0209262_1022625423300027841FreshwaterLRQLSPKRYRNVTVMDRGFSEEAIVGVKPVADEDAVTYPRVKLPESDREVGAEGRNM
Ga0209345_1008473043300027852MarineMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDRDVGAKGRNM
Ga0209345_1036467523300027852MarineMDRGSSDEAIVGVKSVADDDAVTYLRVKLSESDRKVGAEGWNM
Ga0209165_1005081813300027978Marine SedimentVTVTDRGSSDEAKVGVKPVADEDAVTYPRIKLSESDKDVGAEGWNM
Ga0256845_111629123300028029Tube Worm SurfaceMGRGSSEEAIVGVKLVADEDAVTYPRVKLPESDKDVGAEGWNM
Ga0265296_101443943300028032GroundwaterMGRGSSEEAIVGVKPVAEDDAVTYLRVKLSESDREVGAEGRNM
Ga0265296_118377923300028032GroundwaterMDRGSSDEAIVGVKPIADDDAVTYPRVKLSVSDREVGAEGRNM
Ga0210336_102620313300028528EstuarineMDRGSSDEAKVGVKLIAEEDAVTYLRVKLSESDKDVGAEGWN
Ga0265295_109081423300028601Landfill LeachateMDRGFSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM
Ga0265295_111613723300028601Landfill LeachateGLSGHSNVCVTGRGSSEEAIVGVKPVANEDAVTYLRVKLPESDREVGAEGRNM
Ga0272441_1015957023300028920Marine SedimentVTVMDRGSAEEAVVGVKPVADEDAVTYPRIKLSESDMDVGAEGWNM
Ga0310040_103951223300030493Bioremediated Contaminated GroundwaterSDEAIVGVKPAADEDAVTYPRVKLLASDKDVGAEGRNM
Ga0307431_111197813300031278Salt MarshMGRGSSDEAIVGVKPVADEDTVTYLRVKLLESDREVGAEGRNM
Ga0307990_113206023300031645MarineMDRGFSDEAIVGVKPAADEDAVTYQRVKLLESDSNVGAEGRNM
Ga0315550_114068513300031653Salt Marsh SedimentMDRGSTDEAVVGVKSVADEDAVTYLRVKLPESDREVGAEGWNM
Ga0307988_103030213300031741MarineGVKLVADEGVVTHLRVKLSESDKDVGAEGWNMWHGF
Ga0316189_1004338243300032272Worm BurrowMGRGSSEEAIVGVKSVADEDAVTYPRVKLPESDKEVGAEGQNM
Ga0316189_1072942013300032272Worm BurrowVIVTDRGSSEEAIVGVKVIAEEGAATYLRIKLSPSDKDVGAEGWNM
Ga0315286_1174143513300032342SedimentMDQGSADEAVVAVKSGADEGAAMYLRIKLPESGQEVRGEGWNM
Ga0214472_1038859923300033407SoilVVVMDRGSSDEAIVGVKSVAGEDAATYLRIKLPESDKDVGAEGWSM
Ga0214472_1074515623300033407SoilVSVTDRGSSEEAIVGVKPVADEDAVTYLRVKLPESDREVGAEGRNM
Ga0316588_112977523300033528RhizosphereMDRGSAEEAVVGVKPVADEDTVTYLRIKLQESDRDVGAEGWNVLLRTGISE
Ga0370480_0117327_448_5793300034169Untreated Peat SoilMDRGSSEEAIVGVKSVADEDAVTCPRVKLPESDKEVGAEGRNM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.