Basic Information | |
---|---|
IMG/M Taxon OID | 3300009848 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118233 | Gp0131527 | Ga0118742 |
Sample Name | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - F3ET |
Sequencing Status | Permanent Draft |
Sequencing Center | Molecular Research LP (MR DNA) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 54298688 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → wood |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Lacaze-Duthiers Canyon | |||||||
Coordinates | Lat. (o) | 42.4666667 | Long. (o) | 3.4666667 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036294 | Metagenome / Metatranscriptome | 170 | Y |
F078089 | Metagenome | 116 | Y |
F096629 | Metagenome / Metatranscriptome | 104 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0118742_104746 | Not Available | 2132 | Open in IMG/M |
Ga0118742_120112 | Not Available | 656 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0118742_104746 | Ga0118742_1047463 | F036294 | MDRGSSDEAIVGVKLVASEDTVTCLRVKLPESDMDVGAEGRNM* |
Ga0118742_120112 | Ga0118742_1201121 | F078089 | LPEGKIIEQAYVILLKLDKNKEALVNNDWGKIGKKT* |
Ga0118742_121997 | Ga0118742_1219972 | F096629 | MSTPGKQPESSSMTYEEEEEMQHDIAKLRDQVQQVSLAQK |
⦗Top⦘ |