3300006231: Marine sediment microbial communities, 2.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC278

Overview

Basic Information

• IMG/M Taxon OID: 3300006231
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116840 | Gp0121735 | Ga0082391
• Sample Name: Marine sediment microbial communities, 2.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC278
• Sequencing Status: Permanent Draft
• Sequencing Center: Yale Center for Genome Analysis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 25472622
• Sequencing Scaffolds: 5
• Novel Protein Genes: 5
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina	1
All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.3
  • Long. (^o): -88.2
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030135	Metagenome / Metatranscriptome	186	Y
F036294	Metagenome / Metatranscriptome	170	Y
F056191	Metagenome / Metatranscriptome	138	Y
F082866	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0082391_120063	Not Available	1139
Ga0082391_121111	Not Available	718
Ga0082391_124066	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina	732
Ga0082391_126028	Not Available	748
Ga0082391_131546	All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1	1502

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0082391_120063	Ga0082391_1200631	F056191	MLTAEMFEILFSWGSMHASMKLEGIDGRAPPERVEHVA*
Ga0082391_121111	Ga0082391_1211111	F030135	SSITDIGHSTFAGRQFPDAILPGREAVDLVAGPLN*
Ga0082391_124066	Ga0082391_1240661	F036294	MDRGSSDEAIVGVKSVADEDTVTYLRVKLSESGSDAGAEGRNM*
Ga0082391_126028	Ga0082391_1260281	F030135	EELATLSSFTDIGHSTFVGCQFPDAILPGEEAIDLVAGPLN*
Ga0082391_131546	Ga0082391_1315463	F082866	MHHQLPNRKRTINLLLRKASGSGKIYVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQDPKPSGFPRYASEPAYEMVSFKA*