3300001256: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MR6A (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300001256
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0067861 | Gp0054768 | Ga0001192
• Sample Name: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MR6A (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1174355931
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Elkhorn Slough, Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.83
  • Long. (^o): -121.785
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036294	Metagenome / Metatranscriptome	170	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12210J13797_11057125	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina	639
JGI12210J13797_11057126	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina	1240

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12210J13797_11057125	JGI12210J13797_110571251	F036294	VTVMDRGSAEEAVVGVKPVADEGTVTYLRIKLQESDRDVGAEGRNMLLRTGISE*
JGI12210J13797_11057126	JGI12210J13797_110571261	F036294	MDRGSAEEAVVGVKPVADEGTVTYLRIKLQESDRDVGAEGRNMLLRTGISE*