Basic Information | |
---|---|
IMG/M Taxon OID | 3300011255 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121704 | Gp0173495 | Ga0151667 |
Sample Name | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, permeate |
Sequencing Status | Permanent Draft |
Sequencing Center | Toyama Prefectural University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 99852466 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
All Organisms → Viruses → unclassified viruses → Virus sp. | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans LMG 9581 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Environmental Dna From Seawater And Marine Sediment |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Japan Sea near Toyama Prefecture, JAPAN | |||||||
Coordinates | Lat. (o) | 37.31041 | Long. (o) | 137.23108 | Alt. (m) | N/A | Depth (m) | 11 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001611 | Metagenome / Metatranscriptome | 663 | N |
F006971 | Metagenome / Metatranscriptome | 361 | Y |
F036294 | Metagenome / Metatranscriptome | 170 | Y |
F066838 | Metagenome / Metatranscriptome | 126 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0151667_1004005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1113 | Open in IMG/M |
Ga0151667_1092812 | All Organisms → Viruses → unclassified viruses → Virus sp. | 662 | Open in IMG/M |
Ga0151667_1093650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans LMG 9581 | 537 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0151667_1004005 | Ga0151667_10040052 | F036294 | MDRGSSDEAIVGVKPVADEDAVTYLRIKLSESGRDAGAEGRNM* |
Ga0151667_1092812 | Ga0151667_10928121 | F066838 | LAQEFFIKSADLENKVRQLLPSQGGLGAGFDLSASTQIVPIIDLTESAEGSNLRQDLQKALSTAGTSYTATSTTTVFNNTGFVRNFGTVY |
Ga0151667_1092812 | Ga0151667_10928122 | F001611 | MPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYLNNDLLTTGSQRNRVLVRFTNDTSATRTIRCGVFIGG* |
Ga0151667_1093650 | Ga0151667_10936501 | F006971 | MTYQGIEYKKHQKVKFVIPTDNRIIDPQTKRILWKYGTIQFLANNKISAWVLEKGTKEPIKISLFCILPVH* |
⦗Top⦘ |