| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300011255 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121704 | Gp0173495 | Ga0151667 |
| Sample Name | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, permeate |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Toyama Prefectural University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 99852466 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1 |
| All Organisms → Viruses → unclassified viruses → Virus sp. | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans LMG 9581 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Environmental Dna From Seawater And Marine Sediment |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Japan Sea near Toyama Prefecture, JAPAN | |||||||
| Coordinates | Lat. (o) | 37.31041 | Long. (o) | 137.23108 | Alt. (m) | N/A | Depth (m) | 11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001611 | Metagenome / Metatranscriptome | 663 | N |
| F006971 | Metagenome / Metatranscriptome | 361 | Y |
| F036294 | Metagenome / Metatranscriptome | 170 | Y |
| F066838 | Metagenome / Metatranscriptome | 126 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0151667_1004005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1113 | Open in IMG/M |
| Ga0151667_1092812 | All Organisms → Viruses → unclassified viruses → Virus sp. | 662 | Open in IMG/M |
| Ga0151667_1093650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Calidifontibacillus/Schinkia group → Schinkia → Schinkia azotoformans → Schinkia azotoformans LMG 9581 | 537 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0151667_1004005 | Ga0151667_10040052 | F036294 | MDRGSSDEAIVGVKPVADEDAVTYLRIKLSESGRDAGAEGRNM* |
| Ga0151667_1092812 | Ga0151667_10928121 | F066838 | LAQEFFIKSADLENKVRQLLPSQGGLGAGFDLSASTQIVPIIDLTESAEGSNLRQDLQKALSTAGTSYTATSTTTVFNNTGFVRNFGTVY |
| Ga0151667_1092812 | Ga0151667_10928122 | F001611 | MPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYLNNDLLTTGSQRNRVLVRFTNDTSATRTIRCGVFIGG* |
| Ga0151667_1093650 | Ga0151667_10936501 | F006971 | MTYQGIEYKKHQKVKFVIPTDNRIIDPQTKRILWKYGTIQFLANNKISAWVLEKGTKEPIKISLFCILPVH* |
| ⦗Top⦘ |