NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051162

Metagenome / Metatranscriptome Family F051162

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051162
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 112 residues
Representative Sequence MPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAST
Number of Associated Samples 130
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 13.99 %
% of genes near scaffold ends (potentially truncated) 40.97 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 126
AlphaFold2 3D model prediction Yes
3D model pTM-score0.82

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.611 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated
(36.806 % of family members)
Environment Ontology (ENVO) Unclassified
(58.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.167 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 21.43%    Coil/Unstructured: 53.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.82
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.80.1.0: Tautomerase/MIFd4lkba14lkb0.73
d.80.1.0: Tautomerase/MIFd4lkba14lkb0.73
d.80.1.2: Tautomerase/MIFd1otga_1otg0.72
d.80.1.2: Tautomerase/MIFd1otga_1otg0.72
d.80.1.3: Tautomerase/MIFd3kana_3kan0.71
d.80.1.0: Tautomerase/MIFd4lhpa_4lhp0.71
d.80.1.3: Tautomerase/MIFd3kana_3kan0.71
d.80.1.0: Tautomerase/MIFd4lhpa_4lhp0.71
d.80.1.6: Tautomerase/MIFd2aala12aal0.7
d.80.1.6: Tautomerase/MIFd2aala12aal0.7


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF00023Ank 2.78
PF04072LCM 1.39
PF01764Lipase_3 1.39
PF04716ETC_C1_NDUFA5 1.39
PF01490Aa_trans 0.69
PF00505HMG_box 0.69
PF00089Trypsin 0.69
PF03547Mem_trans 0.69
PF01553Acyltransferase 0.69
PF07890Rrp15p 0.69
PF136402OG-FeII_Oxy_3 0.69
PF02675AdoMet_dc 0.69
PF12706Lactamase_B_2 0.69
PF12352V-SNARE_C 0.69
PF03067LPMO_10 0.69
PF02020W2 0.69
PF01494FAD_binding_3 0.69
PF00270DEAD 0.69
PF03935SKN1_KRE6_Sbg1 0.69
PF06325PrmA 0.69
PF00704Glyco_hydro_18 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.39
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.39
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.69
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.69
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.69
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.69
COG0679Predicted permease, AEC (auxin efflux carrier) familyGeneral function prediction only [R] 0.69
COG0814Amino acid permeaseAmino acid transport and metabolism [E] 0.69
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 0.69
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 0.69
COG2273Beta-glucanase, GH16 familyCarbohydrate transport and metabolism [G] 0.69
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.69
COG3397Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domainsGeneral function prediction only [R] 0.69
COG3897Protein N-terminal and lysine N-methylase, NNT1/EFM7 familyPosttranslational modification, protein turnover, chaperones [O] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.31 %
UnclassifiedrootN/A0.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352023|CgraS_DRAFT__Contig_2267All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta51590Open in IMG/M
3300002154|JGI24538J26636_10075406All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta807Open in IMG/M
3300005826|Ga0074477_1464905All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae2130Open in IMG/M
3300005826|Ga0074477_1707186All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales15440Open in IMG/M
3300005982|Ga0075156_10129268All Organisms → cellular organisms → Eukaryota1393Open in IMG/M
3300005988|Ga0075160_10291788All Organisms → cellular organisms → Eukaryota → Sar891Open in IMG/M
3300005989|Ga0075154_10410598All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta747Open in IMG/M
3300006393|Ga0075517_1315881All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta531Open in IMG/M
3300006394|Ga0075492_1390410All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta504Open in IMG/M
3300006396|Ga0075493_1308420All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta533Open in IMG/M
3300006410|Ga0099656_131798All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta569Open in IMG/M
3300006415|Ga0099654_10513793All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta852Open in IMG/M
3300006803|Ga0075467_10022395All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi4058Open in IMG/M
3300008156|Ga0100218_10467All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales18504Open in IMG/M
3300008156|Ga0100218_11145All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta12083Open in IMG/M
3300008156|Ga0100218_11530All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira10217Open in IMG/M
3300008263|Ga0114349_1210699All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta688Open in IMG/M
3300008936|Ga0103739_1054644All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta563Open in IMG/M
3300008938|Ga0103741_1053549All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta778Open in IMG/M
3300009006|Ga0103710_10155741All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta604Open in IMG/M
3300009195|Ga0103743_1062705All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta556Open in IMG/M
3300009265|Ga0103873_1004580All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica1538Open in IMG/M
3300009432|Ga0115005_10002766All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta13988Open in IMG/M
3300009436|Ga0115008_10003891All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta12366Open in IMG/M
3300009543|Ga0115099_10485277All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta504Open in IMG/M
3300009543|Ga0115099_10536076All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta625Open in IMG/M
3300009592|Ga0115101_1178960All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta598Open in IMG/M
3300009592|Ga0115101_1464644All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta697Open in IMG/M
3300009592|Ga0115101_1569071All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta586Open in IMG/M
3300010389|Ga0136549_10009429All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6643Open in IMG/M
3300010883|Ga0133547_10137125All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta5332Open in IMG/M
3300011186|Ga0136553_1020875All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1422Open in IMG/M
3300012408|Ga0138265_1005498All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta506Open in IMG/M
3300012408|Ga0138265_1200900All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta572Open in IMG/M
3300012412|Ga0138266_1327287All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta758Open in IMG/M
3300016718|Ga0186424_114059All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta622Open in IMG/M
3300016801|Ga0186076_106715All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta889Open in IMG/M
3300016816|Ga0186683_111400All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta650Open in IMG/M
3300016826|Ga0186699_113047All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta556Open in IMG/M
3300016828|Ga0186353_101225All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae1835Open in IMG/M
3300016840|Ga0186700_100326All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica2690Open in IMG/M
3300016848|Ga0186065_114358All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta597Open in IMG/M
3300016861|Ga0186095_112038All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta632Open in IMG/M
3300016872|Ga0186662_111005All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta656Open in IMG/M
3300016896|Ga0186663_111525All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta693Open in IMG/M
3300016898|Ga0186068_109978All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta892Open in IMG/M
3300016903|Ga0186238_109216All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300016910|Ga0186199_105398All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1748Open in IMG/M
3300016919|Ga0186448_100220All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6759Open in IMG/M
3300016928|Ga0186573_114067All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta709Open in IMG/M
3300016929|Ga0186537_111642All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta616Open in IMG/M
3300016939|Ga0186572_114621All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta698Open in IMG/M
3300016950|Ga0186266_107159All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta670Open in IMG/M
3300016953|Ga0186066_115202All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta620Open in IMG/M
3300016955|Ga0186207_114777All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta749Open in IMG/M
3300016977|Ga0186642_114930All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta576Open in IMG/M
3300016985|Ga0186682_113732All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta724Open in IMG/M
3300016990|Ga0186367_106444All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Cyclophorales → Cyclophoraceae → Cyclophora → Cyclophora tenuis1028Open in IMG/M
3300016993|Ga0186351_113956All Organisms → cellular organisms → Eukaryota → Sar760Open in IMG/M
3300016994|Ga0186588_112606All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta578Open in IMG/M
3300017001|Ga0186142_111242All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis752Open in IMG/M
3300017018|Ga0186494_113299All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta688Open in IMG/M
3300017040|Ga0186254_114185All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta547Open in IMG/M
3300017043|Ga0186528_108584All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1078Open in IMG/M
3300017051|Ga0186317_115340All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta793Open in IMG/M
3300017077|Ga0186075_101550All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana2433Open in IMG/M
3300017078|Ga0186565_114564All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta700Open in IMG/M
3300017079|Ga0186531_109817All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1500Open in IMG/M
3300017082|Ga0186335_117089All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta841Open in IMG/M
3300017096|Ga0186267_106657All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1556Open in IMG/M
3300017100|Ga0186162_120090All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta608Open in IMG/M
3300017114|Ga0186529_105167All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa2106Open in IMG/M
3300017121|Ga0186562_114718All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta725Open in IMG/M
3300017133|Ga0186595_108034All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1363Open in IMG/M
3300017147|Ga0186457_118354All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta553Open in IMG/M
3300017147|Ga0186457_118376All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta551Open in IMG/M
3300017151|Ga0186544_116030All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta528Open in IMG/M
3300017160|Ga0186067_104007All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana2557Open in IMG/M
3300017161|Ga0186557_113199All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta852Open in IMG/M
3300017191|Ga0186556_113854All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta856Open in IMG/M
3300017233|Ga0186366_112195All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta762Open in IMG/M
3300017239|Ga0186658_119968All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta503Open in IMG/M
3300017265|Ga0186431_114562All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta739Open in IMG/M
3300017292|Ga0186302_125259All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta556Open in IMG/M
3300017302|Ga0186336_118081All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta801Open in IMG/M
3300017603|Ga0187680_104703All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta650Open in IMG/M
3300017606|Ga0187682_104505All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta674Open in IMG/M
3300017608|Ga0187669_106742All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta719Open in IMG/M
3300017788|Ga0169931_10254327All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1431Open in IMG/M
3300018428|Ga0181568_11204484All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta568Open in IMG/M
3300018710|Ga0192984_1013619All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1617Open in IMG/M
3300018739|Ga0192974_1070401All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta570Open in IMG/M
3300018893|Ga0193258_1162505All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta713Open in IMG/M
3300018911|Ga0192987_1177699All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
3300018948|Ga0192985_1145677All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta821Open in IMG/M
3300018980|Ga0192961_10076149All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1000Open in IMG/M
3300019012|Ga0193043_10348241All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta518Open in IMG/M
3300019133|Ga0193089_1033218All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1246Open in IMG/M
3300020431|Ga0211554_10116793All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1342Open in IMG/M
3300021282|Ga0210303_1107591All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1329Open in IMG/M
3300021299|Ga0210302_1072192All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1220Open in IMG/M
3300021303|Ga0210308_1111246All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta587Open in IMG/M
3300021312|Ga0210306_1160691All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1557Open in IMG/M
3300021317|Ga0210309_1080860All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta582Open in IMG/M
3300021335|Ga0213867_1208643All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta646Open in IMG/M
3300021356|Ga0213858_10055066All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1929Open in IMG/M
3300021371|Ga0213863_10447617All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta515Open in IMG/M
3300021373|Ga0213865_10045227All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica2448Open in IMG/M
3300021373|Ga0213865_10272573All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta801Open in IMG/M
3300021379|Ga0213864_10135956All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1236Open in IMG/M
3300021388|Ga0213875_10015471All Organisms → Viruses → Predicted Viral3712Open in IMG/M
3300021389|Ga0213868_10677034All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300021425|Ga0213866_10571641All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta531Open in IMG/M
3300021907|Ga0214480_103976All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2661Open in IMG/M
3300021907|Ga0214480_107482All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta917Open in IMG/M
3300021915|Ga0214477_102751All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica5013Open in IMG/M
3300021927|Ga0063103_1053044All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta682Open in IMG/M
3300021934|Ga0063139_1054224All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta571Open in IMG/M
3300021941|Ga0063102_1016335All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta635Open in IMG/M
3300021950|Ga0063101_1071970All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta549Open in IMG/M
3300022389|Ga0210318_1090039All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta615Open in IMG/M
3300025848|Ga0208005_1176622All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta664Open in IMG/M
3300027776|Ga0209277_10240632All Organisms → cellular organisms → Eukaryota → Sar751Open in IMG/M
3300027849|Ga0209712_10015611All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta5340Open in IMG/M
3300028600|Ga0265303_11185416All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta635Open in IMG/M
3300030670|Ga0307401_10200496All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta900Open in IMG/M
3300030670|Ga0307401_10349089All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta672Open in IMG/M
3300030709|Ga0307400_10826046All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta571Open in IMG/M
3300031223|Ga0307981_1022545All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2620Open in IMG/M
3300031566|Ga0307378_10465927All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1142Open in IMG/M
3300031725|Ga0307381_10285385All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta592Open in IMG/M
3300031739|Ga0307383_10394794All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta679Open in IMG/M
3300031742|Ga0307395_10197441All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta855Open in IMG/M
3300031743|Ga0307382_10620972All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300031750|Ga0307389_11024665All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta548Open in IMG/M
3300031752|Ga0307404_10518447All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta502Open in IMG/M
3300031873|Ga0315297_10867344All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta751Open in IMG/M
3300032073|Ga0315315_10105169All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2629Open in IMG/M
3300032273|Ga0316197_10137542All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1473Open in IMG/M
3300032522|Ga0314677_10350412All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta786Open in IMG/M
3300033572|Ga0307390_10680962All Organisms → cellular organisms → Eukaryota → Sar644Open in IMG/M
3300033572|Ga0307390_10894164All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta561Open in IMG/M
3300033572|Ga0307390_10913064All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta555Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated36.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.58%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.50%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.56%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.17%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.47%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.78%
SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Seawater2.08%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.08%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.08%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.39%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.69%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.69%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.69%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.69%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.69%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.69%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.69%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.69%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.69%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.69%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.69%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.69%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.69%
Chaetoceros Gracilis EnrichedEngineered → Lab Enrichment → Defined Media → Marine Media → Unclassified → Chaetoceros Gracilis Enriched0.69%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.69%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352023C. gracilis enrichmentEngineeredOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300005826Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBAEnvironmentalOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006410Algae and Fungi communities from freshwater lake in Auvergne, France - collected at the beginning of algae bloom, incubated in lab for 4 dayEnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300008156Minidiscus trioculatus Co-assemblyEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011186Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #430EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016718Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in L1 medium, 20 C, 21 psu salinity and 455 ?mol photons light - Leptocylindrus danicus CCMP 1856 (MMETSP1362)Host-AssociatedOpen in IMG/M
3300016801Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium w/o nitrate, at 20 C, 30 psu salinity and 538 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0726)Host-AssociatedOpen in IMG/M
3300016816Metatranscriptome of coastal eukaryotic communities from Mediterranean Sea in K medium, 20 C, 36 psu salinity and 301 ?mol photons light - Leptocylindrus aporus B651 (MMETSP0322)Host-AssociatedOpen in IMG/M
3300016826Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 14 C, 36 psu salinity and 153 ?mol photons light - Skeletonema menzellii CCMP 793 (MMETSP0603)Host-AssociatedOpen in IMG/M
3300016828Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in Standard Aquil medium with 100 uM EDTA, 12 C, 32 psu salinity and 763 ?mol photons light - Chaetoceros sp. UNC1202 (MMETSP1429)Host-AssociatedOpen in IMG/M
3300016840Metatranscriptome of coastal eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 14 C, 35 psu salinity and 460 ?mol photons light - Thalassiosira gravida GMp14c1 (MMETSP0492)Host-AssociatedOpen in IMG/M
3300016848Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 765 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0751)Host-AssociatedOpen in IMG/M
3300016861Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, at 18 C, 32 psu salinity and 492 ?mol photons light - Chaetoceros affinis CCMP 159 (MMETSP0090)Host-AssociatedOpen in IMG/M
3300016872Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 4nM Fe, 12.5um EDTA, 20 C, 35 psu salinity and 390 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0911)Host-AssociatedOpen in IMG/M
3300016896Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 4nM Fe, 12.5um EDTA, 0.4uM Phosphate, 20 C, 35 psu salinity and 398 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0912)Host-AssociatedOpen in IMG/M
3300016898Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium with nocodazole, at 20 C, 30 psu salinity and 748 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0727)Host-AssociatedOpen in IMG/M
3300016903Metatranscriptome of marine eukaryotic communities from Sargasso Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 505 ?mol photons light - Helicotheca tamesis CCMP 826 (MMETSP1171)Host-AssociatedOpen in IMG/M
3300016910Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium, at 20 C, 30 psu salinity and 572 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0744)Host-AssociatedOpen in IMG/M
3300016919Metatranscriptome of marine eukaryotic communities from Great Salt Lake in f/2 medium with seawater, 29 C, 35 psu salinity and 209 ?mol photons light - Chaetoceros sp. GSL56 (MMETSP0200_2)Host-AssociatedOpen in IMG/M
3300016928Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 14nM iron, 19 C, 35 psu salinity and 610 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1415)Host-AssociatedOpen in IMG/M
3300016929Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 7 C, 32 psu salinity and 374 ?mol photons light - Dactyliosolen fragilissimus (MMETSP0580)Host-AssociatedOpen in IMG/M
3300016939Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 14nM iron, 19 C, 35 psu salinity and 614 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1416)Host-AssociatedOpen in IMG/M
3300016950Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium with nocodazole, 20 C and 207 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0708)Host-AssociatedOpen in IMG/M
3300016953Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 584 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0724)Host-AssociatedOpen in IMG/M
3300016955Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater, 20nM total Fe, at 20 C, 35 psu salinity and 563 ?mol photons light - Thalassiosira weissflogii CCMP 1336 (MMETSP0880)Host-AssociatedOpen in IMG/M
3300016977Metatranscriptome of freshwater eukaryotic communities from unknown location in FSW medium, at 6 C, 21 psu salinity and 662 ?mol photons light - Aulacoseira subarctica CCAP 1002/5 (MMETSP1064)Host-AssociatedOpen in IMG/M
3300016985Metatranscriptome of coastal eukaryotic communities from Mediterranean Sea in K medium, 20 C, 36 psu salinity and 677 ?mol photons light - Leptocylindrus danicus B650 (MMETSP0321)Host-AssociatedOpen in IMG/M
3300016990Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 23 C, 34 psu salinity and 120 ?mol photons light - Cyclophora tenuis ECT3854 (MMETSP0397)Host-AssociatedOpen in IMG/M
3300016993Metatranscriptome of marine eukaryotic communities from North Sea in f/2 medium, 13 C, 21 psu salinity and 210 ?mol photons light - Corethron hystrix 308 (MMETSP0010_2)Host-AssociatedOpen in IMG/M
3300016994Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 494 ?mol photons light - Minutocellus polymorphus RCC 2270 (MMETSP1322)Host-AssociatedOpen in IMG/M
3300017001Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium, at 15 C, 36 psu salinity and 651 ?mol photons light - Odontella Sinensis Grunow 1884 (MMETSP0160_2)Host-AssociatedOpen in IMG/M
3300017018Metatranscriptome of marine eukaryotic communities from Baffin Bay in L1 medium with seawater, 2 C, 33 psu salinity and 481 ?mol photons light - Attheya septentrionalis CCMP 2084 (MMETSP1449)Host-AssociatedOpen in IMG/M
3300017040Metatranscriptome of marine eukaryotic communities from Ross Sea in L1 medium with NH4Cl, 4 C, 32 psu salinity and 517 ?mol photons light - Synedropsis cf. recta CCMP 1620 (MMETSP1176)Host-AssociatedOpen in IMG/M
3300017043Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 14 C, 21 psu salinity and 445 ?mol photons light - Licmophora paradoxa CCMP 2313 (MMETSP1360)Host-AssociatedOpen in IMG/M
3300017051Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater, 14 C, 36 psu salinity and 382 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP0998)Host-AssociatedOpen in IMG/M
3300017077Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium w/o nitrate, at 20 C, 30 psu salinity and 736 ?mol photons light - Thalassiosira minuscula CCMP 1093 (MMETSP0739)Host-AssociatedOpen in IMG/M
3300017078Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron w/o nitrate, 14 C, 35 psu salinity and 444 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP0901_2)Host-AssociatedOpen in IMG/M
3300017079Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 150 ?mol photons light - Cyclotella meneghiniana CCMP 338 (MMETSP1057)Host-AssociatedOpen in IMG/M
3300017082Metatranscriptome of marine eukaryotic communities from Pacific Ocean in Aquil medium, 13 C, 21 psu salinity and 224 ?mol photons light - Ditylum brightwellii Pop1 (SS4) (MMETSP1062)Host-AssociatedOpen in IMG/M
3300017096Metatranscriptome of marine eukaryotic communities from Pacific Ocean in L1 medium, 20 C, 21 psu salinity and 454 ?mol photons light - Staurosira sp. CCMP2646 (MMETSP1361)Host-AssociatedOpen in IMG/M
3300017100Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, at 5 C, 35 psu salinity and 561 ?mol photons light - Thalassiosira antarctica CCMP 982 (MMETSP0905)Host-AssociatedOpen in IMG/M
3300017114Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 436 ?mol photons light - Amphiprora paludosa CCMP 125 (MMETSP1065)Host-AssociatedOpen in IMG/M
3300017121Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 10.6uM silica, 19 C, 35 psu salinity and 656 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1409)Host-AssociatedOpen in IMG/M
3300017133Metatranscriptome of marine eukaryotic communities from Arabian Sea in K medium with silica, 15 C, 21 psu salinity and 683 ?mol photons light - Rhizosolenia setigera CCMP 1694 (MMETSP0789)Host-AssociatedOpen in IMG/M
3300017147Metatranscriptome of marine eukaryotic communities from English Channel in K medium with silica, 15 C, 21 psu salinity and 310 ?mol photons light - Skeletonema costatum 1716 (MMETSP0013_2)Host-AssociatedOpen in IMG/M
3300017151Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater, 14 C, 36 psu salinity and 165 ?mol photons light - Skeletonema dohrnii SkelB (MMETSP0562)Host-AssociatedOpen in IMG/M
3300017160Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 549 ?mol photons light - Thalassiosira minuscula CCMP 1093 (MMETSP0737)Host-AssociatedOpen in IMG/M
3300017161Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 19 C, 35 psu salinity and 644 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1407)Host-AssociatedOpen in IMG/M
3300017191Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 4nM iron, 19 C, 35 psu salinity and 139 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP0899_2)Host-AssociatedOpen in IMG/M
3300017233Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 27 C, 0 psu salinity and 313 ?mol photons light - Astrosyne radiata 13vi08-1A (MMETSP0418)Host-AssociatedOpen in IMG/M
3300017239Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in f/2 medium, 18 C, 35 psu salinity and 96 ?mol photons light - Thalassiosira rotula CCMP 3096 (MMETSP0403)Host-AssociatedOpen in IMG/M
3300017265Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with silicate, 20 C, 21 psu salinity and 315 ?mol photons light - Stephanopyxis turris CCMP 815 (MMETSP0794_2)Host-AssociatedOpen in IMG/M
3300017292Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium, 13 C, 21 psu salinity and 616 ?mol photons light - Odontella aurita 1302-5 (MMETSP0015_2)Host-AssociatedOpen in IMG/M
3300017302Metatranscriptome of marine eukaryotic communities from Pacific Ocean in 21 psu salinity and 373 ?mol photons light - Thalassiosira punctigera Tpunct2005C2 (MMETSP1067)Host-AssociatedOpen in IMG/M
3300017603Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o silicate, 20 C, 29 psu salinity and 692 ?mol photons light - Chaetoceros curvisetus (MMETSP0717) (SRX549071-SRR1294457)Host-AssociatedOpen in IMG/M
3300017606Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o silicate, 20 C, 29 psu salinity and 692 ?mol photons light - Chaetoceros curvisetus (MMETSP0717) (SRX549070-SRR1294456)Host-AssociatedOpen in IMG/M
3300017608Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, at 18 C, 32 psu salinity and 534 ?mol photons light - Chaetoceros affinis CCMP 159 (MMETSP0092) (SRX549063-SRR1294449)Host-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018893Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789445-ERR1719354)EnvironmentalOpen in IMG/M
3300018911Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001042 (ERX1809744-ERR1740134)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021312Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021907Marine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellE17EnvironmentalOpen in IMG/M
3300021915Marine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellC16EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022389Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027776Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)EngineeredOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031223Marine microbial communities from Ellis Fjord, Antarctic Ocean - #987EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032273Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxicEnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
CgraS_DRAFT_002786002199352023Chaetoceros Gracilis EnrichedMPLVKLFARKTLSKPVNLSSLQQKLCSIWNTKPDTTKLILTRVDDWTNDSFQEDIYVDIRAYGKKERTRDMVMDGMQQVQKAFGEEGLVANVRLEVYDGEKYFHLPPPPSTPQN
JGI24538J26636_1007540613300002154MarineIQQMMCDVWGTKPETTKLILTRVDDWTEDSFNEDVYVDIRAYGKAERTRDFVLDGMKTIQKNLKDEHELVVNVRLETYDGERYFHVPPPN*
Ga0074477_146490523300005826Sediment (Intertidal)MPLVKLFARSNLSKAVPLASLQSKLCEIWGTKPETTKLLLFRCEDWTDCESFQPEDVYVDIRAYGKSERTREFVLDGMKSVQRAFAEQDLVANVRLETYEGDRYFHVPPPDKKGS*
Ga0074477_170718613300005826Sediment (Intertidal)MPLVKLFARNTLSKAVPLKALQTELCKIWGTKPETTKLMLFRCEDWTDCDTFTPEDVYVDIRAYGKSERTRDFVLEGMESVQRAFAGHNLVANVRLETYEGDRYFHVPPPAPS*
Ga0075156_1012926823300005982Wastewater EffluentMPLVKLFAQRSMHKPIPLAKLQSALCEIWKTQPNTTKLILFRVDDWTDESFKEDVYVDIRAKATPDRKPENILDGMQRVQQAFKNENLIANVRLETYAGPQYFHLPPSDS*
Ga0075160_1029178823300005988Wastewater EffluentMHKPIPLAKLQSALCEIWKTQPNTTKLILFRVDDWTDESFKEDVYVDIRAKATPDRKPENILDGMQRVQQAFKNENLIANVRLETYAGPQYFHLPPSDS*
Ga0075154_1041059813300005989Wastewater EffluentMPLVKIFARSGLTKPIPLQALQTQLCQIWNTKPDTTKLLLTRVDDWTDESFAEDVYVDIRAMARPERTRDMVLGGMQQVQDAFQTHDLVANVRLETYDSPNYFHLPPSSPHVNKTD*
Ga0075517_131588113300006393AqueousGNVHITSIMPLVKIFALNTLRKPIPLKELQSSLCRIWGTKPDTTKLMLTRCEDMTNDEFNEDVYVDIRAYGKPERTRETVLDGMKDVQSAFLEKDLIANVRLETYEGVRYFHLPPTVKK*
Ga0075492_139041013300006394AqueousIDSQKQVHPTMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQNAFAEENLVANVIQA*
Ga0075493_130842023300006396AqueousKIFARVGMSKAIPLQTLQSQLCKIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLDGMTQIQGAFAEHDLVANVRLETYDGERYFHVPPKK*
Ga0099656_13179813300006410LakeMPLVKIFAKTGMAKAIPLSALQAKLCNIWAVKPNVTKVMLFRCDDWTDDSFQEDCYVDIRAKGTDQRTREVVLDSMKQVQIAFKEHGLIANVRLETYDESRYFHLPPLSTNV*
Ga0099654_1051379313300006415LakeMPLVKIFSRSSLRKPIPLQALQSHLCQIWNTKPDTTKLILTRVEDWTDESFSEDVYVDIRAMARPERTRQAVLDGVRQVQEAFKKHNLIANVRLETYDNQNYFHLPPPIIS*
Ga0075467_1002239513300006803AqueousMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAST*
Ga0100218_10467133300008156MarineMPLVKVFTRVGMTKSIPLSSLQSKLCDIWGTKPETTKIILQRVEDWTSDSFHEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEFDLLANVRLETYEGERYFHVPPPKK*
Ga0100218_11145103300008156MarineMPLVKVFTRVGMKKSIPLSALQSKLCNIWGTKPETTKIILQRVEDWTADSFNEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEHDLVANVRLETYDGERYFHVPPPK*
Ga0100218_11530123300008156MarineMPLVKVFTRVGMKKSIPLSTLQSKLCDIWGTKPETTKIILQRVEDWTSDSFNEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEHDLLANVRLETYDGERYFHVPPPKK*
Ga0114349_121069913300008263Freshwater, PlanktonMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILLRAEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMAQVQKAFAEENLVANVRLETYDGERYFHVPPPKAS
Ga0103739_105464413300008936Ice Edge, Mcmurdo Sound, AntarcticaCSSFNGMGFRKVFNAKSAEIDTTMPLIKIFALNTLRKPIPLKELQSRLCNIWGTKPDTTKLMLTRCEDMTNDEFNEDVYVDIRAYGKSERTREMVLDGMKDVQSAFLENGLIANVRLETYEGERYFHVPPVKK*
Ga0103741_105354913300008938Ice Edge, Mcmurdo Sound, AntarcticaMPLVKIFARHALTKPIPLASLQSALCQIWGTKPSTTKILLQRVDDWTDDSFQEDCYVDIRAYGKPERTREVVLQGMTAVQGAFKDEGLIANVRLETYEGERYFHVPPPSEEGN*
Ga0103710_1015574113300009006Ocean WaterMPLVKIFARNTLSKQVPLAAIQAKLCDIWGTKPNTTKLILQRVEDWTDESFQEDCYVDIRAYGKAERTREVVLDGMKKVQDAFGDHDLIANVRLETYEGERYFHCPPTEK*
Ga0103743_106270513300009195Ice Edge, Mcmurdo Sound, AntarcticaNGMGFRKVFNANILMRGIVVLISALFALNTLRKPIPLKELQSRLCNIWGTKPDTTKLMLTRCEDMTNDEFNEDVYVDIRAYGKSERTREMVLDGMKDVQSAFLENGLIANVRLETYEGERYFHVPPVKI*
Ga0103873_100458023300009265Surface Ocean WaterMPLVKIFARTGMNKAIPLQALQSKLCSIWSTKPETTKLILSRVEEMTENPYEDCYVDIRAYGKSERTREFVLGGMAEVQQAFADHDLIANVRLETYEGERYFHVPPAK*
Ga0115005_1000276653300009432MarineMPLVKLFARQTLSKPINLASLQSKLCSIWNTKPNTTKLILTRVDDWTDESFQEDVYVDIRAYGKAERTREMVLDGMQKVQSAFGEEGLIANVRLETYDGEKYFHVPPKDDADAASK*
Ga0115008_1000389193300009436MarineMPLVEIFARQCMTKVIPLNALQSRMCAIWGTTPETTKLILNRVEDWTTSGLVDEDCYVSIRAKGTEQRTRTIVLDGMKQVQNCFAQEGLIANVRLETYEGERYFHVPPPMKK*
Ga0115099_1019158413300009543MarineTAYYYFYCLWLRYISFALSFYSNEVTMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFEEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKTSTK*
Ga0115099_1048527713300009543MarineMPLVKIFARVGMNKAIPLSALQSKMCKIWGTKPETTKLILSRVEDWTSDSFNEDCYIDIRAYGKSERTRELVLDNMQEIQKVFLEDHDLVANVRLETYDGEKYFHLPPKK*
Ga0115099_1053607613300009543MarineMPLVKIFARVGMQKAIPLPALQSKLCDIWGTKPETTKLILSRVEDWTSESFNEDCYIDIRAYDKPERTREFVLEGMEKVQDAFADYDLVANVRLEAYNGEKYFHVTPKK*
Ga0115101_117896013300009592MarineMKKSIPLSALQSKLCNIWGTKPETTKIILQRVEDWTADSFNEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEHDLVANVRLETYDGERYFHVPPPK*
Ga0115101_146464423300009592MarineFCNVPNLIIIIHNTTQPLHLPIKRKMPLVKLFARQTLTKPINLQSLQSKLCSIWSTKPNTTKLILTRVDDWTDESFQEDIYVDIRAYGKSERTREMVLDGMKQVQSAFGEEGLIANVRLETYDGERYFHVPPTEEAGGK*
Ga0115101_156907123300009592MarineMQKAIPLPALQSKLCDIWGTKPETTKLILSRVEDWTSESFNEDCYIDIRAYDKPERTREFVLEGMEKVQDAFADYDLVANVRLEAYNGEKYFHVTPKK*
Ga0136549_1000942933300010389Marine Methane Seep SedimentMPLVKLFARTALTKPIPLASMQSMMCNVWGTQPETTKLILTRVDDWTEDSFHEDIYVDIRAYGKAERTRDFVLEGMRTIQRHLKADHDLVANVRLETYEGERYFHVPPPKSD*
Ga0133547_1013712533300010883MarineMPLVKLFALRTLTKPVNLASLQSKLCSIWSTKPDTTKLILTRVDEWTGESFQEDIYVDIRAYGKSERTREMVLDGMDKVQGAFKEEGLIANVRLETYNGENYFHLPPKK*
Ga0136553_102087523300011186Saline LakeMPLVKLFARQTLTKPINLAAIQSKLCNIWSTKPNTTKLILTRVDDWTDESFQEDIYVDIRAYGKAERTREMVLDGMHKVQGAFKEEGLIANVRLETYDGEKYFHVPPKE*
Ga0138265_100549813300012408Polar MarineTLTKPINLASIQSKLCSIWSTKPDTTKLILTRVEDWTDESFQEDIYVDIRAYGKAERTREMVLDGMHKVQGAFKEEGLIANVRLETYDGEKYFHVPPPKE*
Ga0138265_120090013300012408Polar MarineTLPSITSTTLHHAPETKEHKRTMPLVKIFARKTLSKPIPLTTLQSHLCKIWGTKPDTTKLMLSRVDDWTDDSFQEDCYVDVRAYGKPERTREIVLDGMEKVQGAFKDCGLIANVRLETYEPERYFHLPPKEDEDRK*
Ga0138266_132728713300012412Polar MarineMPLVKLFARQTLTKPINLASIQSKLCSIWSTKPDTTKLILTRVEDWTDESFQEDIYVDIRAYGKAERTREMVLDGMHKVQGAFKEEGLIANVRLETYDGEKYFHVPPPKE*
Ga0186424_11405913300016718Host-AssociatedMPLVEIFARKCMAKPIPLSSLQASMCKIWGTTPETTKLILSRVEDWTTSGLQDEDCYVSIRAKGTEQRTREIVLDGMKQVSDAFSTHDLVANVRLETYEGARYFHVPPPMKK
Ga0186076_10671513300016801Host-AssociatedSIAAIDTMPLVKLFARNSLTKAVPLPRLQEKLCGIWGTKPSTTKLMLFRCEDWTDESFQEDVYVDIRAYGKAERTREFVLDGMKDVQKAFAEEDLIANVRLETYEGERYFHVPPSSENSS
Ga0186683_11140013300016816Host-AssociatedMPLVEIFARQCMTKVIPLNALQSRMCAIWGTTPETTKLILNRVEDWTTSGLVDEDCYVSIRAKGTEQRTRTIVLDGMKQVQNCFAQEGLIANVRLETYEGERYFHVPPPMKN
Ga0186699_11304713300016826Host-AssociatedMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAST
Ga0186353_10122523300016828Host-AssociatedMPLVKLFARQTLTKPINLQSIQSKLCSIWNTKPNTTKLILTRVDDWTDESFAEDVYVDIRAYGKAERTREMVLDGMEKVQGAFGEEGLVANVRLETYEGERYFHVPPKEAK
Ga0186700_10032613300016840Host-AssociatedMPLVKIFARVGMNKAIPLKTLQSQMCKIWSTKPETTKLILSRVEDWTSESYDEDCYIDIRAYGKSERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK
Ga0186065_11435813300016848Host-AssociatedMPLVKIFARQALTKQVPLTKLQSKLCSIWNTKPNTTKLILFRVEDWTNESYHEDVYVDIRAYGKAERTREMVLVGMQDVQKAFQEHDLVANVRLETYDGEKYFHVPPGGGN
Ga0186095_11203823300016861Host-AssociatedFARQTLTKSIPLKTLQNRLCEIWGTKPNTTKLILSRVDDWTDESFREDVYVDIRAYGKAERTREMVLDGMNKVQGAFGEEGLIANVRLETYEGERYFHVPPSDK
Ga0186662_11100513300016872Host-AssociatedYFAMPLVKIFARVGMNKAIPLKTLQSQMCKIWSTKPETTKLVLSRVEDWTSESYDEDCYIDIRAYGKTERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK
Ga0186663_11152513300016896Host-AssociatedNLCQYSFPFLLVYFAMPLVKIFARVGMNKAIPLKTLQSQMCKIWSTKPETTKLVLSRVEDWTSESYDEDCYIDIRAYGKTERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK
Ga0186068_10997813300016898Host-AssociatedAIDTMPLVKLFARNSLTKAVPLPRLQEKLCGIWGTKPSTTKLMLFRCEDWTDESFQEDVYVDIRAYGKAERTREFVLDGMKDVQKAFAEEDLIANVRLETYEGERYFHVPPSSENSS
Ga0186238_10921623300016903Host-AssociatedMPLVKIFARSKLSKPIPLSALQSKLCDIWGTKPNTTKLMLTRVDDWTEDSYYEDCYVDIRAYGKAERTREVVLDGMKRVQGAFKEHDLVANVRLETYEGERYFHVPPPDQSEEK
Ga0186199_10539813300016910Host-AssociatedKIFAKQTMKKPINLASLQSKMCNIWGTKPNTTKLMLCRVEDWTDESFQEDCYVDIRAYGKAERTREMVLDGMEKVQASFLDHGLVANVRLETYDGERYFHVPPKAPKS
Ga0186448_10022033300016919Host-AssociatedMPLVKLFARKTLSKPINLSSLQQKLCSIWNTKPDTTKLILTRVDDWTDDSFKEDIYVDIRAYGKKERTRDMVFEGMKQVQHAFGEEGLVANVRLEVYDGEKYFHLPPPSNPQP
Ga0186573_11406713300016928Host-AssociatedVNYDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186537_11164213300016929Host-AssociatedMPLVHVFARTSLSKPISLQSIQSKLCKIWGTKPQTTKIILTRVEDWTHDYDEDVYVSIRAYGKPERTREFVLDGMVNVQKAFQDESLVANVRLETYDGERYFHVPPKT
Ga0186572_11462113300016939Host-AssociatedRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186266_10715913300016950Host-AssociatedMPLVKIFARTTMAKPIPLAAIQSKLCDIWGTKPNTTKLMLSRVEDWTDESFQEDCYVDIRAYGKPERTREMVLDGMQKVQGAFKEHDLIANGKFDL
Ga0186066_11520213300016953Host-AssociatedHCCMKTPCASIAAIDTMPLVKLFARNSLTKAVPLPRLQEKLCGIWGTKPSTTKLMLFRCEDWTDESFQEDVYVDIRAYGKAERTREFVLDGMKDVQKAFAEEDLIANVRLETYEGERYFHVPPSSENSS
Ga0186207_11477713300016955Host-AssociatedNYDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186642_11493013300016977Host-AssociatedMPLVKIFSRSSLRKPIPLQALQSHLCQIWNTKPDTTKLILTRVEDWTDESFSEDVYVDIRAMARPERTRQAVLDGVRQVQEAFKKHNLIANVRLETYDNQNYFHLPPPIIS
Ga0186682_11373213300016985Host-AssociatedMAKPIPLSSLQASMCKIWGTTPETTKLILSRVEDWTTSGLQDEDCYVSIRAKGTEQRTREIVLDGMKQVSDAFSTHDLVANVRLETYEGARYFHVPPPMKT
Ga0186367_10644413300016990Host-AssociatedSHPTSIKHPTMPLVKIFAKQTMTKPIPLAALQSKLCDIWGTKPNTTKLMLQRVDDWTDESFQEDCYVDIRAKGTEERTREYVLDGMKRVQGAFKEHDLSANVRLATYEGPRYFHVPPSTN
Ga0186351_11395623300016993Host-AssociatedMPLVHIFAKQCLKKTVPLASLQSSLCKIWGTKPNTTKLFLSRVEDWTDESFGEDVYVSIRAMGKDDRTRESVFEGMGQVRDAFGEEGLVANVRLETYEAARYFHLPPTASVPK
Ga0186588_11260613300016994Host-AssociatedPLVKLFARTTLTKAIPLPAIQQMMCDVWGTKPETTKLILTRVDDWTEDSFNEDVYVDIRAYGKAERTRDFVLDGMKTIQKNLKDEHELVVNVRLETYDGERYFHVPPPN
Ga0186142_11124213300017001Host-AssociatedMTKPIPLASLQSKLCKIWGTKPATTKLILSRVEDWTSESFNEDVYVDIRAYGKPERTREFVLDGMKQVQGAFKDHDLIANVRLETYEGERYFHVPPPIPDN
Ga0186494_11329913300017018Host-AssociatedMPLVKIFAKNSMGKPVPLSALQAKLCQIWGTKPNTTKLMLSRVEDWTNDSYAEDCFVDIRAFGKAERTRGMVLDGMNKVQTAFLDEGLVANVRLETYDGTRYFHVPPPEPK
Ga0186254_11418513300017040Host-AssociatedMPLVKIFAKTTMMKTIPLAALQSKLCDIWGTKPNTTKLMLQRVDEWTDESFAEDVYVDIRAKGTDERTREYVLEGMHRVQDAFKSEDLIANVRLETYEGPRYFHLPPPASGSS
Ga0186528_10858423300017043Host-AssociatedMPLVKIFAKHTMAKSIPLAAIQSKLCNIWGTKPNTTKLMLTRCEDWTDESFQEDVYVDIRAKGTEERTREYVLEGMKKVQEAFREHDLIANVRLETYEGPRYFHVPPPSS
Ga0186317_11534013300017051Host-AssociatedMPLVKIFARSTLTKPIPLSALQSKLCDIWGTKPNTTKLMLSRVDDWTEDSYYEDCYVDIRAYGKAERTREVVLDGMKRVQGAFKEHDLIANVRLETYEGERYFHVPPPDPVEEK
Ga0186075_10155033300017077Host-AssociatedHCCRFAHTINHLLLPHYLTSTIVSTMPLVKVFARVGMNKAIPLQSLQSKLCKIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLEGMTQVQQAFADHDLIANVRLETYDGERYFHVPPKK
Ga0186565_11456413300017078Host-AssociatedDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186531_10981733300017079Host-AssociatedLSARATLPSLYVPTTRVSFHGMPLVKVFARAGMNKAIPLVALQSKLCEIWGTKPETTKLMLSRVEDWTSDHKEDCYIDIRAYGKSERTRDFVLEGMKKVQNAFAEFDLVANVRLETYDGEKYFHVPP
Ga0186335_11708913300017082Host-AssociatedMPLVKIFARSTLTKPIPLSALQSKLCDIWGTKPNTTKLMLSRVDNWTEDSYYEDCYVDIRAYGKAERTREVVLDGMKRVQGAFKEHDLIANVRLETYEGERYFHVPPPDPVEEK
Ga0186267_10665723300017096Host-AssociatedMPLVKIFARATMNKPIRLAVLQSKLCDVWRTKPNTTKLMLFRVEDWTDESFQEDCYVDIRAKGTEERTRDYVLDGMTQVQEAFRDENLIANVRLETYEGERYFHVPPPVEK
Ga0186162_12009013300017100Host-AssociatedMPLVKIFARVGMNKAIPLTSLQSKLCKIWSTKPETTKLILSRVEDWTSDSYDEDCYIDIRAYGKSERTREFVLDGMTQVQQAFAEHDLAANVRLETYDGERYFHVPPKK
Ga0186529_10516723300017114Host-AssociatedLDDTPRKARQLFPTLHLTVSTNIMPLVKLFARSNLKKTVPLPRLQEKLCGIWGTKPSTTKLMLFRCEDWTDESFQEDVYVDIRAYGKAERTREFVLDGMKDIQKAFAEEDLIANVRLETYEGERYFHVPPTSDAK
Ga0186562_11471813300017121Host-AssociatedVPVNYDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186595_10803423300017133Host-AssociatedMPLVKLFVHRNLTKPVNLPSIQSKLCAIWGVKPETTKCLLTRVDDWTTTYKQEDIYVDIRAYGKAERTREMVLDGMKKVQKAFEEENLVANVRLETYEGERYFHLPPPEDK
Ga0186457_11835413300017147Host-AssociatedMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKASK
Ga0186457_11837613300017147Host-AssociatedLACIHRHPLDQVHPTMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAST
Ga0186544_11603023300017151Host-AssociatedMPLVKVFAQVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAST
Ga0186067_10400713300017160Host-AssociatedLLHCCRFAHTINHLLLPHYLTSTIVSTMPLVKVFARVGMNKAIPLQSLQSKLCKIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLEGMTQVQQAFADHDLIANVRLETYDGERYFHVPPKK
Ga0186557_11319913300017161Host-AssociatedLVPVNYDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186556_11385413300017191Host-AssociatedPVNYDRLTMPLVKIFARNGMTKSIPLTTLQSKLCGIWGTKPETTKLMLSRVDDWTSDHKEDCYVDIRAYGKPERTRDFVLDGMAKVQQAFAEHDLAANVRLETYEGERYFHVPPKNS
Ga0186366_11219513300017233Host-AssociatedTTAPLLCPPLTTTTSASIRLLSMPLVKIFAKQTLQKPIPLVPLQSKLCDIWGTKPNTTKLMLQRVEDWTNESFQEDCYVDIRAKGTEARTREVVLGGMKKVQDAFREHDLIANVRLETYEGPRYFHLPPTTSS
Ga0186658_11996823300017239Host-AssociatedFPFLLVYFAMPLVKIFARVGMNKAIPLKTLQSQMCKIWSTKPETTKLVLSRVEDWTSESYYEDCYIDIRAYGKTERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK
Ga0186431_11456213300017265Host-AssociatedMPLVKIFARHSLSKHIPLPALQKSLCNIWGTKPNTTKLMLTRVEDWTDESFSEDCYVDIRAKGTPERTREAVLIGMKKVQEAFAEQDLIANIRLETYEGEGYFHVPPSS
Ga0186302_12525923300017292Host-AssociatedMPLVKIFALRSLTKPIPLSSLQSKMCGIWGTKPATTKILLSRIDDWTGDTFDEDCYVDIRAYGKPERTREVVLEGIKRVQEAFKEEGLIANVRLETYEGERYFHVPPLAPEEGS
Ga0186336_11808113300017302Host-AssociatedMNKAIPLQSLQSQLCKIWSTKPETTKLILSRVEDWTSDSYDEDCYIDIRAYGKPERTREFVLDGMTQIQQAFAEHDLIANVRLETYDGERFFHVPPKEK
Ga0187680_10470323300017603Host-AssociatedIEMPLVKLFARKALSKPINLASIQSKLCTIWGTKPNTTKLILTKVDDWTDESFQEDVYVDIRAYGKPERTREMVLDGMEKVQGAFKDEGLIANVRLETYEGERYFHVPPKE
Ga0187682_10450523300017606Host-AssociatedTTAPPTLRYYCIEMPLVKLFARKALSKPINLASIQSKLCTIWGTKPNTTKLILTKVDDWTDESFQEDVYVDIRAYGKPERTREMVLDGMEKVQGAFKDEGLIANVRLETYEGERYFHVPPKE
Ga0187669_10674213300017608Host-AssociatedMPLVKIFARQTLTKSIPLKTLQNRLCEIWGTKPNTTKLILSRVDDWTDESFREDVYVDIRAYGKAERTREMVLDGMNKVQGAFGEEGLIANVRLETYEGERYFHVPPSDK
Ga0169931_1025432713300017788FreshwaterLCSIWNTKPDTTKLILTRVDDWTNDSFQEDIYVDIRAYGKKERTKDMITEGMKRVQHAFREEGLVANVRLEIYDGEKYFHLPPPSNPQP
Ga0181568_1120448413300018428Salt MarshHHLTLRMPLVKVFAKTGMNKAIPLVALQSKLCQIWGTKPETTKLMLTRIEDWTSDHHEDCYIDIRAYGKSERTREFVLSGMMDVQKAFAEFDLVANVRLETYEGERYFHVPPKP
Ga0192984_101361923300018710MarineMPLVKIFARSTLIKTISLPALQSKLCNIWGTQPSTTKLMLTRVDDWTDETFREDVYVDVRAYGRPERTREFVLEGMEKVQAAFGEEGLVANVRLETYDGERYFHVPPKEQDN
Ga0192974_107040113300018739MarineMPLIKIFALNTLRKPIPLKELQSRLCNIWGTKPDTTKLMLTRCEDMTNDEFNEDVYVDIRAYGKSERTREMVLDGMKDVQSAFLENGLIANVRLETYEGERYFHVPPVKK
Ga0193258_116250513300018893MarineLHLPIKRKMPLVKLFARQTLTKPINLQSLQSKLCSIWSTKPNTTKLILTRVDDWTDESFQEDIYVDIRAYGKSERTREMVLDGMKQVQSAFGEEGLIANVRLETYDGERYFHVPPTEEAGGK
Ga0192987_117769913300018911MarineVKIFARSTLIKTISLPALQSKLCNIWGTQPSTTKLMLTRVDDWTDETFREDVYVDVRAYGRPERTREFVLEGMEKVQAAFGEEGLVANVRLETYDGERYFHVPPKEQDN
Ga0192985_114567713300018948MarineMPLVKLFARQSLKKPIPLATLQSKMCAIWGTQPKTTKLILTRADAWTTTEDLPEEDVYVSIRAYGKSERTREFVLDGMVRVQEAFREEGLLANVRLETYDGERYFHVPPPVSSEK
Ga0192961_1007614923300018980MarineHGAIWGTKPDTTKLILSKVDEWTGDTFSEDVYVDIRAYGKAERTREFVLDGMKEVQGAFKHEGLVANVRLETYDGERYFHVPPPLDSGN
Ga0193043_1034824113300019012MarineILSKMPLIKIFALNTLRKPIPLKELQSSLCRIWGTKPNTTKLMLTRCDDMTNDEFNEDVYVDIRAYGKSERTREMVLDGMKDVQSAFLEKGLVANVRLETYDGERYFHLPPAVEK
Ga0193089_103321823300019133MarineMPLVKLYALRTLSKPIPLKSLQSKLCAIWGTKPDTTKLILSKVDEWTGDTFSEDVYVDIRAYGKAERTREFVLDGMKEVQGAFKHEGLVANVRLETYDGERYFHVPPPLDSGN
Ga0211554_1011679313300020431MarineLSKPIPLRAMQASMCRIWGTKPETTKILLSRVDDWTSESFDEDVYVDIRAYGKKERTRDFVLQGMKDVQAAFLDEGLVANVRLECYDGEKYFHVPPPTP
Ga0210303_110759113300021282EstuarineYRHRMVLNYPSMPLVKVFARIGMTKPIPLALLQSKLCAIWSTKPDTTKLILLRSEDWTSDSFDEDCYVDIRAYGKAERTREFVLDGMKQVQQAFAEENLVANVRLETYDGERYFHVPPPKAST
Ga0210302_107219213300021299EstuarineHRMVLNYPSMPLVKVFARIGMTKPIPLALLQSKLCAIWSTKPDTTKLILLRSEDWTSDSFDEDCYVDIRAYGKAERTREFVLDGMKQVQQAFAEENLVANVRLETYDGERYFHVPPPKAS
Ga0210308_111124613300021303EstuarineLSLPYRHRMVLNYPSMPLVKVFARIGMTKPIPLALLQSKLCAIWSTKPDTTKLILLRSEDWTSDSFDEDCYVDIRAYGKAERTREFVLDGMKQVQQAFAEENLVANVRLETYDGERYFHVPPPKAST
Ga0210306_116069123300021312EstuarineMTKPIPLALLQSKLCAIWSTKPDTTKLILLRSEDWTSDSFDEDCYVDIRAYGKAERTREFVLDGMKQVQQAFAEENLVANVRLETYDGERYFHVPPPKAST
Ga0210309_108086013300021317EstuarineSLPYRHRMVLNYPSMPLVKVFARIGMTKPIPLALLQSKLCAIWSTKPDTTKLILLRSEDWTSDSFDEDCYVDIRAYGKAERTREFVLDGMKQVQQAFAEENLVANVRLETYDGERYFHVPPPKAST
Ga0213867_120864313300021335SeawaterMQSMMCKVWGTKPETTKLILTRVDDWTEDSFNEDIYVDIRAYGKAERTRDFVLDGMKTIQQNLKNEHDLVANVRLETYEGERYFHVPPKLTEETK
Ga0213858_1005506613300021356SeawaterMPLVKIFARQTLTKSIPLSSIQSKLCNIWNTKPNTTKLILCRVDDWTNESFHEDVYVDIRAYGKAERTREMVLDGMQKVQTAFGEEGLIANVRLETYDGERYFHVPPSST
Ga0213863_1044761713300021371SeawaterMPLVKVFAKVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSESFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAS
Ga0213865_1004522733300021373SeawaterMPLVKVFTRVGMKKSIPLSSLQSKLCDIWGTKPETTKIILQRVEDWTSDSFHEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGDHDLVANVRLETYDGERYFHVPPPKK
Ga0213865_1027257313300021373SeawaterMPLVEIFARQCMTKVIPLNALQSRMCAIWGTTPETTKLILNRVEDWTTSGLVDEDCYVSIRAKGTEQRTRTIVLDGMKQVQNCFAQEGLIANVRLETYEGERYFHVPPPMKK
Ga0213864_1013595623300021379SeawaterMPLVKVFARVGMAKPIPLQSLQSKLCGIWSTKPETTKLLLSRVEDWTSDSYDEDCYVDIRAYGKAERTRDFVLDGIKEVQQAFAEENLTANVRLETYEGERYFHVPPSKST
Ga0213875_1001547123300021388Plant RootsMPLVKVFTRVGMKKSIPLSTLQSKLCDIWGTKPETTKIILQRVEDWTSDSFNEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEHDLLANVRLETYDGERYFHVPPPKK
Ga0213868_1067703413300021389SeawaterMPLVKVFARVGMTKPIPLASLQSKLCAIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKAERTREFVLDGMTQVQKAFAEENLVANVRLETYEGERYFHVPPPKAST
Ga0213866_1057164113300021425SeawaterMPLVKVFAKTGMNKAIPLVALQSKLCQIWGTKPETTKLMLTRIEDWTSDHHEDCYIDIRAYGKSERTREFVLSGMMDVQKAFAEFDLVANVRLETYEGERYFHVPPKP
Ga0214480_10397613300021907SeawaterMKKSIPLSALQSKLCNIWGTKPETTKIILQRVEDWTADSFNEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEHDLVANVRLETYDGERYFHVPPPK
Ga0214480_10748213300021907SeawaterTKSIPLSSLQSKLCDIWGTKPETTKIILQRVEDWTSDSFHEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEFDLLANVRLETYEGERYFHVPPPKK
Ga0214477_10275133300021915SeawaterMPLVKVFTRVGMTKSIPLSSLQSKLCDIWGTKPETTKIILQRVEDWTSDSFHEDVYIDIRAYGKEERTRDFVLDGMKDVQKAFGEFDLLANVRLETYEGERYFHVPPPKK
Ga0063103_105304413300021927MarineMPLVKIFARVGMSKAIPLQTLQSQLCKIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLDGMTQIQGAFAEHDLVANVRLETYNGERYFHVPPKK
Ga0063139_105422413300021934MarineMPLVKIFAKQTLQKVISLTTLQTKLCHIWKTKPSTTKLILSRVDDWTTANDEIGEEDVYVDIRAYGKSERTREMVMEGMNKVQKAFGEEGLIANVRLETYEGERYFHVPPSPSA
Ga0063102_101633513300021941MarineMPLVKLFARQTLSKPINLASLQSKLCSIWNTKPNTTKLILTRVDDWTDESFQEDVYVDIRAYGKAERTREMVLDGMQKVQSAFGEEGLIANVRLETYDGEKYFHVPPKDDADAASK
Ga0063101_107197013300021950MarineIVPTNNARRIHQHQNPTMPLVKIFARVGMSKAIPLQTLQSQLCKIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLDGMTQIQGAFAEHDLVANVRLETYNGERYFHVPPKK
Ga0210318_109003923300022389EstuarineMPLVKLFARNTLSKAVPLKALQTELCKIWGTKPETTKLMLFRCEDWTDCDTFTPEDVYVDIRAYGKSERTRDFVLEGMESVQRAFAGHNLVANVRLETYEGDRYFHVPPPAPS
Ga0208005_117662223300025848AqueousMPLVKIFARVGMTKPIPLESLQSKLCAIWSTQPETTKLILSRVEDWTSDSFDEDCFIDIRAYGKAERTREFIINGMIEVQQAFAAENLVANLRLETYDGARYFHV
Ga0209277_1024063213300027776Wastewater EffluentMPLVKLFAQRSMHKPIPLAKLQSALCEIWKTQPNTTKLILFRVDDWTDESFKEDVYVDIRAKATPDRKPENILDGMQRVQQAFKNENLIANVRLETYAGPQYFHLPPSDS
Ga0209712_1001561143300027849MarineMPLVKLFALRTLTKPVNLASLQSKLCSIWSTKPNTTKLILTRVDDWTDESFQEDIYVDIRAYGKAERTREVVLDGMHKVQGAFKEEGLIANVRLETYDGETYFHLPPKE
Ga0265303_1118541623300028600SedimentAVAEIKAKMPLVKLFARATLTKQIPLGALQESMCKVWGTKPETTKLILTRVDDWTEDSFKEDVYVDIRAYGKAERTREFVLDGMQEIQKRMKEEHNLVANVRLETYDGERYFHVPPPK
Ga0307401_1020049613300030670MarineMPLVKIFARSTLTKTIALPTLQSKLCAIWGTQPTTTKLILSRVEDWTDSSFHEDVYVDVRAYGKPERTREFVLEGMEKVQAAFGEEGLVANVRLETYEGERYFHVPPPAKEEAK
Ga0307401_1034908913300030670MarineSIFTANLSVSIYIAMPLVKLFARQTLTKPINLAAIQSKLCNIWSTKPNTTKLILTRVDDWTDESFQEDIYVDIRAYGKAERTREMVLDGMHKVQGAFKEEGLIANVRLETYDGEKYFHVPPKE
Ga0307400_1082604613300030709MarineMPLVKIFARAGMTKAIPLQSLQSKLCTIWSTKPETTKLILSRVEDWTSDSFHEDCYIDIRAYGKSERTREFVLDGMTDVQKAFADHDLVANVRLETYDGEKYFHVPPKK
Ga0307981_102254523300031223Saline WaterMPLVKLFARQTLTKPINLAAIQSKLCNIWSTKPNTTKLILTRVDDWTDESFQEDIYVDIRAYGKAERTREMVLDGMHKVQGAFKEEGLIANVRLETYDGEKYFHVPPKE
Ga0307378_1046592713300031566SoilMPLVKLFARHTLTKTINLLSLQSKLCHIWGTQPSTTKVILARVDDWTDESFQEDLYVDIRAYGKAERTREMVLDGMQKVQSAFAEEGLIANVRLETYDGEKYFHVPPKDPSK
Ga0307381_1028538513300031725MarineMPLVKIFARAALSKPVPLSVLQSKLCNIWGTKPNTTKLMLQRVDEWTDESFHEDCYVDIRAKSTSDRTREVVLDGMTQVQEAFKECNLIANVRLETYEGERYFHLPPKK
Ga0307383_1039479413300031739MarineMPLVKIFARATLSKPIPLSALQSKLCNIWGTKPNTTKLMLQRVEDWTDESFSEDCYVDIRAKGTNDRTREVVLDGMSKVQKAFGECNLIANVRLETYEGERYFHLPPGK
Ga0307395_1019744113300031742MarineMPLVKLFARHALSKPINLASLQSKLCNIWGTKPNTTKLILTKVDDWTDESFREDVYVDIRAYGKDERTREMVLDGMQKVQVAFKEEGLIANVRLETYDGERYFHVPPKE
Ga0307382_1062097213300031743MarineMPLVKIFARSSLTKTIALPTLQSKLCAIWGTQPTTTKLMLSRVEDWTDDSFHEDVYVDVRAYGKPERTREFVLEGMEKVQAAFGEEGLVANVRLETYEGERYFHVPPTKEEAK
Ga0307389_1102466523300031750MarineKPINLASLQSKLCNIWGTKPNTTKLILTKVDDWTDESFREDVYVDIRAYGKDERTREMVLDGMQKVQVAFKEEGLIANVRLETYDGERYFHVPPKE
Ga0307404_1051844713300031752MarineKMPLVKIFARSSLTKTIALPVLQSKLCTIWGTQPSTTKLILSRVEDWTDDSFQEDVYVDVRAYGKSERTREFVLQGMEKVQAAFGDEGLVANIRLETYDGERYFHVPPKESKK
Ga0315297_1086734413300031873SedimentMPLVKIFARSALTKPIPLQALQAHLCHIWNTKPDTTKLMLTRVDDWTDESFAEDVYVDIRAMARPERTREAVLDGIQQVQDAFRKHDLIANVRLETYDNQNYFHLPPSGPTV
Ga0315315_1010516923300032073SeawaterMPLVKIFALTTLSKPIPLRAMQASMCRIWGTKPETTKILLSRVDDWTSESFDEDVYVDIRAYGKKERTRDFVLQGMKDVQAAFLDEGLVANVRLECYDGEKYFHVPPPTP
Ga0316197_1013754223300032273SedimentHSDIDIMPLVKIFARAGMAKSIPLQSLQSKLCAVWSTKPETTKLILSRVEDWTSDSFNEDCYVDIRAYGKPERTREFVLEGMEKVQEAFKEEGLIANVRLETYDGERYFHVPPKK
Ga0314677_1035041223300032522SeawaterPKKRSNMPLVKLYALRTLTKPIPLISLQSKLCAIWGTTPDTTKLLLSKVEDWTDDSFAEDVYVDIRAYGKPERTREVVLEGMKQVQGAFQEEGLVANVRLETYDGMKYFHVPPSK
Ga0307390_1068096213300033572MarineKIMPLVKLFALRSLTKPVPLAKLQSKMCAIWGTQPKTTKLILSRVDEWTTATDQPDEDVYVDIRAYGKSERTREFVLGGVTQVQEAFREEGLSANVRLETYDGERYV
Ga0307390_1089416413300033572MarineMPLVKIFARSSLTKTIALPVLQSKLCTIWGTQPSTTKLILSRVEDWTDDSFQEDVYVDVRAYGKSERTREFVLQGMEKVQAAFGDEGLVANIRLETYDGERYFHVPPKESKK
Ga0307390_1091306413300033572MarineMPLVKIFARVGMNKAIPLQTLQSQMCKIWSTKPETTKLILSRVEDWTSESYDEDCYIDIRAYGKSERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.