3300017001: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium, at 15 C, 36 psu salinity and 651 ?mol photons light - Odontella Sinensis Grunow 1884 (MMETSP0160_2)

Overview

Basic Information

• IMG/M Taxon OID: 3300017001
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0211854 | Ga0186142
• Sample Name: Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium, at 15 C, 36 psu salinity and 651 ?mol photons light - Odontella Sinensis Grunow 1884 (MMETSP0160_2)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 22211312
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y
F079510	Metagenome / Metatranscriptome	115	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186142_104025	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1361
Ga0186142_111242	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	752

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186142_104025	Ga0186142_1040251	F079510	MIVLTPSRSTAEKCTALKPLPIDSEDFDQPNWKDIIEIAFPPWEVPAAGCPRLDKIGGALEEGFDEFPTPEDGKFNPCYYTKAFAGLDPKLGGYPTPVDTKYHYEFAAPFFKQPGDGSTHHCPMDASPDTPVQSCPKVAPKCDGAPKDCNKITDEFGIGHVPPFVPLAAVKNALKEITCMEEMCAWFADEVQPCNIAKSVLDGLVISTFGVNGTVKFTPPKILDDLPASDPKSTYYKLEYLGDPVACADDNCRGPHYCSKAAAEEDIWGDFCPYIHTGENSGLYRHPHIALAAVELMLANQCNPEKCPSKWLDSPNGMDYGVEMKSTSITWAEMDDNSDPMAQPAVPYKWPNSGDGIYPGHELYGDYSVKPAAGSYVTKFVAMTSGEGTESSGPAPVTAKAAAMIATAAIASLIM
Ga0186142_111242	Ga0186142_1112421	F051162	MTKPIPLASLQSKLCKIWGTKPATTKLILSRVEDWTSESFNEDVYVDIRAYGKPERTREFVLDGMKQVQGAFKDHDLIANVRLETYEGERYFHVPPPIPDN