3300016977: Metatranscriptome of freshwater eukaryotic communities from unknown location in FSW medium, at 6 C, 21 psu salinity and 662 ?mol photons light - Aulacoseira subarctica CCAP 1002/5 (MMETSP1064)

Overview

Basic Information

• IMG/M Taxon OID: 3300016977
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212354 | Ga0186642
• Sample Name: Metatranscriptome of freshwater eukaryotic communities from unknown location in FSW medium, at 6 C, 21 psu salinity and 662 ?mol photons light - Aulacoseira subarctica CCAP 1002/5 (MMETSP1064)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 28216059
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y
F067805	Metagenome / Metatranscriptome	125	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186642_114930	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	576
Ga0186642_115303	Not Available	545

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186642_114930	Ga0186642_1149301	F051162	MPLVKIFSRSSLRKPIPLQALQSHLCQIWNTKPDTTKLILTRVEDWTDESFSEDVYVDIRAMARPERTRQAVLDGVRQVQEAFKKHNLIANVRLETYDNQNYFHLPPPIIS
Ga0186642_115303	Ga0186642_1153031	F067805	MAGNKKSKAEEEVVLSKKDQKKVSKLEAQIPYYLGRNQPEEVDKVKEQIADIWAKAKQAAFS