x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016977
3300016977: Metatranscriptome of freshwater eukaryotic communities from unknown location in FSW medium, at 6 C, 21 psu salinity and 662 ?mol photons light - Aulacoseira subarctica CCAP 1002/5 (MMETSP1064)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016977 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212354 | Ga0186642 |
| Sample Name | Metatranscriptome of freshwater eukaryotic communities from unknown location in FSW medium, at 6 C, 21 psu salinity and 662 ?mol photons light - Aulacoseira subarctica CCAP 1002/5 (MMETSP1064) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 28216059 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information |
| Location | |
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F051162 | Metagenome / Metatranscriptome | 144 | Y |
| F067805 | Metagenome / Metatranscriptome | 125 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186642_114930 | Ga0186642_1149301 | F051162 | MPLVKIFSRSSLRKPIPLQALQSHLCQIWNTKPDTTKLILTRVEDWTDESFSEDVYVDIRAMARPERTRQAVLDGVRQVQEAFKKHNLIANVRLETYDNQNYFHLPPPIIS |
| Ga0186642_115303 | Ga0186642_1153031 | F067805 | MAGNKKSKAEEEVVLSKKDQKKVSKLEAQIPYYLGRNQPEEVDKVKEQIADIWAKAKQAAFS |