x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016953
3300016953: Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 584 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0724)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016953 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211778 | Ga0186066 |
| Sample Name | Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 584 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0724) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 32515434 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | |
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F051162 | Metagenome / Metatranscriptome | 144 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186066_115202 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 620 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186066_115202 | Ga0186066_1152021 | F051162 | HCCMKTPCASIAAIDTMPLVKLFARNSLTKAVPLPRLQEKLCGIWGTKPSTTKLMLFRCEDWTDESFQEDVYVDIRAYGKAERTREFVLDGMKDVQKAFAEEDLIANVRLETYEGERYFHVPPSSENSS |