x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300016896
3300016896: Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 4nM Fe, 12.5um EDTA, 0.4uM Phosphate, 20 C, 35 psu salinity and 398 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0912)
Overview
| Basic Information |
| IMG/M Taxon OID | 3300016896 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212375 | Ga0186663 |
| Sample Name | Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in F/2 medium with seawater, 4nM Fe, 12.5um EDTA, 0.4uM Phosphate, 20 C, 35 psu salinity and 398 ?mol photons light - Thalassiosira rotula GSO102 (MMETSP0912) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | National Center for Genome Resources |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 18716527 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Rhizochromulinales → Rhizochromulina → Rhizochromulina marina | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Location Information |
| Location | Pacific Ocean |
| Coordinates | Lat. (o) | 48.629353 | Long. (o) | -122.957542 | Alt. (m) | N/A | Depth (m) | .5 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F051162 | Metagenome / Metatranscriptome | 144 | Y |
| F067805 | Metagenome / Metatranscriptome | 125 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0186663_111151 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica | 718 | Open in IMG/M |
| Ga0186663_111525 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 693 | Open in IMG/M |
| Ga0186663_113636 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae → Rhizochromulinales → Rhizochromulina → Rhizochromulina marina | 564 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| Ga0186663_111151 | Ga0186663_1111512 | F067805 | LKLDRKEQKKVDKLTAQIPYHQGRGNMEEVTKIKGQIDSIWEKAKEAQFA |
| Ga0186663_111525 | Ga0186663_1115251 | F051162 | NLCQYSFPFLLVYFAMPLVKIFARVGMNKAIPLKTLQSQMCKIWSTKPETTKLVLSRVEDWTSESYDEDCYIDIRAYGKTERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK |
| Ga0186663_113636 | Ga0186663_1136361 | F067805 | MGRKQQPKEEELTLSKKEQKKVDKLSAQIPYHQGRGNMEEVTKIKGQIDSIWEKAKEAQF |