3300016985: Metatranscriptome of coastal eukaryotic communities from Mediterranean Sea in K medium, 20 C, 36 psu salinity and 677 ?mol photons light - Leptocylindrus danicus B650 (MMETSP0321)

Overview

Basic Information

• IMG/M Taxon OID: 3300016985
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212394 | Ga0186682
• Sample Name: Metatranscriptome of coastal eukaryotic communities from Mediterranean Sea in K medium, 20 C, 36 psu salinity and 677 ?mol photons light - Leptocylindrus danicus B650 (MMETSP0321)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 29485124
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → coastal water body → coastal sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Mediterranean Sea
• Coordinates
  • Lat. (^o): 40.8083
  • Long. (^o): 14.25
  • Alt. (m): N/A
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186682_113732	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	724

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186682_113732	Ga0186682_1137321	F051162	MAKPIPLSSLQASMCKIWGTTPETTKLILSRVEDWTTSGLQDEDCYVSIRAKGTEQRTREIVLDGMKQVSDAFSTHDLVANVRLETYEGARYFHVPPPMKT