x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017239
3300017239: Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in f/2 medium, 18 C, 35 psu salinity and 96 ?mol photons light - Thalassiosira rotula CCMP 3096 (MMETSP0403)
Overview
Basic Information |
IMG/M Taxon OID | 3300017239 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0212370 | Ga0186658 |
Sample Name | Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in f/2 medium, 18 C, 35 psu salinity and 96 ?mol photons light - Thalassiosira rotula CCMP 3096 (MMETSP0403) |
Sequencing Status | Permanent Draft |
Sequencing Center | National Center for Genome Resources |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 36505283 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 1 |
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Location Information |
Location | Pacific Ocean |
Coordinates | Lat. (o) | 49.65 | Long. (o) | -127.4338 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F051162 | Metagenome / Metatranscriptome | 144 | Y |
F099352 | Metatranscriptome | 103 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0186658_116422 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 806 | Open in IMG/M |
Ga0186658_119968 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 503 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0186658_116422 | Ga0186658_1164222 | F099352 | MVTSPFNGEEAFKGAGAPSLSSEVSVTSNSNRVFLDSQELNAASGPFNLCCSQAYARFTELKRLKLHPGNMTKERDDVESCSANVYKGIQSSCVDQFEAVKACLSNNPDEWAQCASVRRELEVCSVRNNLGELKK |
Ga0186658_119968 | Ga0186658_1199682 | F051162 | FPFLLVYFAMPLVKIFARVGMNKAIPLKTLQSQMCKIWSTKPETTKLVLSRVEDWTSESYYEDCYIDIRAYGKTERTREFVLDGMTQIQQAFAEHDLIANVRLETYEGERYFHVPPKK |