NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017233

3300017233: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 27 C, 0 psu salinity and 313 ?mol photons light - Astrosyne radiata 13vi08-1A (MMETSP0418)



Overview

Basic Information
IMG/M Taxon OID3300017233 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212078 | Ga0186366
Sample NameMetatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 27 C, 0 psu salinity and 313 ?mol photons light - Astrosyne radiata 13vi08-1A (MMETSP0418)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25447972
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis1
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)13.4427Long. (o)144.6428Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y
F067805Metagenome / Metatranscriptome125Y
F081743Metagenome / Metatranscriptome114Y
F089930Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186366_101389All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis2598Open in IMG/M
Ga0186366_101457All Organisms → Viruses → Predicted Viral2563Open in IMG/M
Ga0186366_104826All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1603Open in IMG/M
Ga0186366_112195All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta762Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186366_101389Ga0186366_1013893F067805MGGKKNKQAEEVQLSKKDAKKVAKLEAQIPYYQGRGQNDEVDKIKEQIETIWTKAREAAY
Ga0186366_101457Ga0186366_1014573F081743MLERNIEDPLWLDVDCPKFGLMAEMSRVIRVSFSSEIDGLYFHKSFKGSGHPFYDSVYRKAARINKDLADHMDTCIVR
Ga0186366_104826Ga0186366_1048262F089930GYLSKAIGRRGDKAALEPLSLYDILEVKAGCSGYDHTELPSASSKKSGKKGKNDNRQASLFLTIKATPTPEASFRSYILKFKSRGARNDVLNGLRSILADMQIHEGVSISSLQQGEDEEEDEILVPLSEVHNAINREREAYDRLLLLLLQGQEDLKEKEDEMLGLRGKLENVVAESADKDRVQANDSKLIMQLSKKLETLLMDNEDLRDQNDRLNARLVSVECEKMNLMSG
Ga0186366_112195Ga0186366_1121951F051162TTAPLLCPPLTTTTSASIRLLSMPLVKIFAKQTLQKPIPLVPLQSKLCDIWGTKPNTTKLMLQRVEDWTNESFQEDCYVDIRAKGTEARTREVVLGGMKKVQDAFREHDLIANVRLETYEGPRYFHLPPTTSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.