NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016898

3300016898: Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium with nocodazole, at 20 C, 30 psu salinity and 748 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0727)



Overview

Basic Information
IMG/M Taxon OID3300016898 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0211780 | Ga0186068
Sample NameMetatranscriptome of marine eukaryotic communities from unknown location in NEPC medium with nocodazole, at 20 C, 30 psu salinity and 748 ?mol photons light - Amphiprora sp. CCMP467 (MMETSP0727)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25518667
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051162Metagenome / Metatranscriptome144Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186068_109978All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta892Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186068_109978Ga0186068_1099781F051162AIDTMPLVKLFARNSLTKAVPLPRLQEKLCGIWGTKPSTTKLMLFRCEDWTDESFQEDVYVDIRAYGKAERTREFVLDGMKDVQKAFAEEDLIANVRLETYEGERYFHVPPSSENSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.