x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300017160
3300017160: Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 549 ?mol photons light - Thalassiosira minuscula CCMP 1093 (MMETSP0737)
Overview
Basic Information |
IMG/M Taxon OID | 3300017160 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128947 | Gp0211779 | Ga0186067 |
Sample Name | Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium, at 20 C, 30 psu salinity and 549 ?mol photons light - Thalassiosira minuscula CCMP 1093 (MMETSP0737) |
Sequencing Status | Permanent Draft |
Sequencing Center | National Center for Genome Resources |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 45708324 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 1 |
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Location Information |
Location | |
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F051162 | Metagenome / Metatranscriptome | 144 | Y |
F099352 | Metatranscriptome | 103 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0186067_104007 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 2557 | Open in IMG/M |
Ga0186067_121717 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi | 727 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0186067_104007 | Ga0186067_1040071 | F051162 | LLHCCRFAHTINHLLLPHYLTSTIVSTMPLVKVFARVGMNKAIPLQSLQSKLCKIWSTKPETTKLILSRVEDWTSDSFDEDCYIDIRAYGKSERTREFVLEGMTQVQQAFADHDLIANVRLETYDGERYFHVPPKK |
Ga0186067_121717 | Ga0186067_1217171 | F099352 | PNPKPTPPQTQTAAVIVKFSIMVTSSFSGEEAFKGLGAPSLKSEVSVTSNSNRVLLDSEELNAASGAFNLCCAEAYSRFSELKRLKVHPGNMTKERDDVESCSANVYNGIQSSCTEQFEAVKSCLSDNPKNWAQCASARRELEVCSVRNNLGELKK |