3300016910: Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium, at 20 C, 30 psu salinity and 572 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0744)

Overview

Basic Information

• IMG/M Taxon OID: 3300016910
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0211911 | Ga0186199
• Sample Name: Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium, at 20 C, 30 psu salinity and 572 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0744)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 26631944
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045520	Metagenome / Metatranscriptome	152	Y
F051162	Metagenome / Metatranscriptome	144	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186199_104972	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	1829
Ga0186199_105398	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae	1748

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186199_104972	Ga0186199_1049721	F045520	MAFNRLYKQIETLIRTDDEVADSIPCKSDILSLRECRKGGKTCDDLGLELLRCMAQYKVDTTEKIRQAIGVAKYNEYVKAMVEKHGKEKAEEIIAEPSEQLKDIEAYQVLHRVANNTHPKGAPKTAEGIKEWTYADQVRLEMGEQEWWDAVKIVGCEFGVEKADALFGLAKEKELIESAQDRLVPGLKEKRAQGLEAYKKVEASVKEAAPGAKSPADYAAAFKDLYPTKEDLESALK
Ga0186199_105398	Ga0186199_1053981	F051162	KIFAKQTMKKPINLASLQSKMCNIWGTKPNTTKLMLCRVEDWTDESFQEDCYVDIRAYGKAERTREMVLDGMEKVQASFLDHGLVANVRLETYDGERYFHVPPKAPKS