3300017133: Metatranscriptome of marine eukaryotic communities from Arabian Sea in K medium with silica, 15 C, 21 psu salinity and 683 ?mol photons light - Rhizosolenia setigera CCMP 1694 (MMETSP0789)

Overview

Basic Information

• IMG/M Taxon OID: 3300017133
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212307 | Ga0186595
• Sample Name: Metatranscriptome of marine eukaryotic communities from Arabian Sea in K medium with silica, 15 C, 21 psu salinity and 683 ?mol photons light - Rhizosolenia setigera CCMP 1694 (MMETSP0789)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 30948229
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Arabian Sea
• Coordinates
  • Lat. (^o): 23.5643
  • Long. (^o): 58.853
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y
F078213	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186595_108034	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1363
Ga0186595_113047	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	868

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186595_108034	Ga0186595_1080342	F051162	MPLVKLFVHRNLTKPVNLPSIQSKLCAIWGVKPETTKCLLTRVDDWTTTYKQEDIYVDIRAYGKAERTREMVLDGMKKVQKAFEEENLVANVRLETYEGERYFHLPPPEDK
Ga0186595_113047	Ga0186595_1130471	F078213	MWNPPAVNNMMSRNDEDSLKALGEAYKNAADNIGIKNLAPKKIEDTLRQGGTFIFKGEEPLLQHFDAKVGDNCDIESILQAIGTK