3300016903: Metatranscriptome of marine eukaryotic communities from Sargasso Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 505 ?mol photons light - Helicotheca tamesis CCMP 826 (MMETSP1171)

Overview

Basic Information

• IMG/M Taxon OID: 3300016903
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0211950 | Ga0186238
• Sample Name: Metatranscriptome of marine eukaryotic communities from Sargasso Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 505 ?mol photons light - Helicotheca tamesis CCMP 826 (MMETSP1171)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 13205699
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Sargasso Sea
• Coordinates
  • Lat. (^o): 30.0
  • Long. (^o): -60.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186238_109216	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	500

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186238_109216	Ga0186238_1092162	F051162	MPLVKIFARSKLSKPIPLSALQSKLCDIWGTKPNTTKLMLTRVDDWTEDSYYEDCYVDIRAYGKAERTREVVLDGMKRVQGAFKEHDLVANVRLETYEGERYFHVPPPDQSEEK