Metagenome / Metatranscriptome Family F069722

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F069722
Family Type	Metagenome / Metatranscriptome
Number of Sequences	123
Average Sequence Length	40 residues
Representative Sequence	MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE
Number of Associated Samples	81
Number of Associated Scaffolds	121

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	56.91 %
% of genes near scaffold ends (potentially truncated)	43.90 %
% of genes from short scaffolds (< 2000 bps)	82.11 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.683 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (47.154 % of family members)
Environment Ontology (ENVO)	Unclassified (94.309 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (87.805 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 10.29% β-sheet: 0.00% Coil/Unstructured: 89.71%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.18
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 121 Family Scaffolds
PF13495	Phage_int_SAM_4	4.96
PF07883	Cupin_2	4.13
PF13248	zf-ribbon_3	1.65
PF05598	DUF772	1.65
PF06231	DUF1010	1.65
PF13673	Acetyltransf_10	0.83
PF00849	PseudoU_synth_2	0.83
PF13427	DUF4111	0.83
PF00893	Multi_Drug_Res	0.83
PF13424	TPR_12	0.83
PF02963	EcoRI	0.83
PF09851	SHOCT	0.83
PF08937	DUF1863	0.83
PF09406	DUF2004	0.83
PF13240	zinc_ribbon_2	0.83
PF08768	THAP4_heme-bd	0.83
PF07366	SnoaL	0.83
PF06305	LapA_dom	0.83
PF00144	Beta-lactamase	0.83
PF00005	ABC_tran	0.83
PF13006	Nterm_IS4	0.83
PF08327	AHSA1	0.83
PF05163	DinB	0.83
PF12686	DUF3800	0.83
PF07799	DUF1643	0.83
PF14237	GYF_2	0.83
PF10987	DUF2806	0.83
PF14833	NAD_binding_11	0.83
PF04471	Mrr_cat	0.83
PF14491	DUF4435	0.83

COG ID	Name	Functional Category	% Frequency in 121 Family Scaffolds
COG0564	Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific	Translation, ribosomal structure and biogenesis [J]	0.83
COG1187	Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605	Translation, ribosomal structure and biogenesis [J]	0.83
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.83
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.83
COG2076	Multidrug transporter EmrE and related cation transporters	Defense mechanisms [V]	0.83
COG2318	Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.83
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.83
COG3771	Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family	Cell wall/membrane/envelope biogenesis [M]	0.83
COG4333	Uncharacterized conserved protein, DUF1643 domain	Function unknown [S]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.68 %
Unclassified	root	N/A	7.32 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.68 %
Unclassified	root	N/A	7.32 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.68 %
Unclassified	root	N/A	7.32 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	56.10 %
Unclassified	root	N/A	7.32 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.63 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.81 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	22.76 %
Unclassified	root	N/A	7.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6.50 %
Lentisphaerae	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae	0.81 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.81 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.81 %

Name	Rank	Taxonomy	Distribution
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	17.89 %
Unclassified	root	N/A	7.32 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	2.44 %
unclassified Lentisphaerota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota	0.81 %
Moraxellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales	0.81 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	0.81 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.81 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.81 %
Gammaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis	0.81 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.81 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	0.81 %

Name	Rank	Taxonomy	Distribution
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	14.63 %
Unclassified	root	N/A	7.32 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	2.44 %
Candidatus Kentron	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron	0.81 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.81 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.81 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.81 %
Chloroflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	0.81 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.81 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	0.81 %
Moraxellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.32 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	4.07 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	2.44 %
Chloroflexineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae	0.81 %
unclassified Candidatus Kentron	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron	0.81 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.81 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	0.81 %
Escherichia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia	0.81 %
Acinetobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter	0.81 %
Ottowia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia	0.81 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.81 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.32 %
unclassified Acidovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax	2.44 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	2.44 %
Ottowia oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae	0.81 %
Candidatus Kentron sp. LPFa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. LPFa	0.81 %
Oscillochloridaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae	0.81 %
Aeromonas caviae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas caviae	0.81 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.81 %
Cyanobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	0.81 %
Acinetobacter towneri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri	0.81 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.81 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.32 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	2.44 %
Acidovorax sp. JS42	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42	0.81 %
Candidatus Viridilinea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Candidatus Viridilinea	0.81 %
Acidovorax sp. JG5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5	0.81 %
Acidovorax sp. W1-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. W1-6	0.81 %
Ottowia oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae	0.81 %
Candidatus Kentron sp. LPFa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. LPFa	0.81 %
Aeromonas caviae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas caviae	0.81 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.81 %
Cyanobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	0.81 %
Acinetobacter towneri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri	0.81 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.81 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.32 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	2.44 %
Candidatus Viridilinea halotolerans	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Candidatus Viridilinea → Candidatus Viridilinea halotolerans	0.81 %
Acidovorax sp. JS42	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42	0.81 %
Acidovorax sp. JG5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5	0.81 %
Acidovorax sp. W1-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. W1-6	0.81 %
Ottowia oryzae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae	0.81 %
Candidatus Kentron sp. LPFa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. LPFa	0.81 %
Aeromonas caviae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas caviae	0.81 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.81 %
Cyanobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	0.81 %
Acinetobacter towneri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri	0.81 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.81 %
Lentisphaerae bacterium RIFOXYA12_FULL_48_11	species	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2013843001\|PLMO_FPCF17101_b1	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	836	Open in IMG/M
3300000052\|Draft_c061527	All Organisms → cellular organisms → Bacteria	2572	Open in IMG/M
3300001096\|JGI11944J13513_1054006	All Organisms → cellular organisms → Bacteria	780	Open in IMG/M
3300001592\|Draft_10028506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3936	Open in IMG/M
3300001592\|Draft_10352203	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300002098\|JGI24219J26650_1005720	All Organisms → cellular organisms → Bacteria → Proteobacteria	2486	Open in IMG/M
3300002223\|C687J26845_10001412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	14893	Open in IMG/M
3300002596\|draft_1353451	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300003408\|JGI26524J50256_1002483	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	10878	Open in IMG/M
3300003764\|Ga0056910_1006079	Not Available	2298	Open in IMG/M
3300003764\|Ga0056910_1006079	Not Available	2298	Open in IMG/M
3300003764\|Ga0056910_1007557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	1894	Open in IMG/M
3300003764\|Ga0056910_1023945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ottowia → Ottowia oryzae	786	Open in IMG/M
3300003767\|Ga0056908_1004510	All Organisms → cellular organisms → Bacteria → Proteobacteria	3220	Open in IMG/M
3300003767\|Ga0056908_1004872	All Organisms → cellular organisms → Bacteria → Proteobacteria	3013	Open in IMG/M
3300003844\|Ga0056914_10024895	All Organisms → cellular organisms → Bacteria	1893	Open in IMG/M
3300004463\|Ga0063356_102124640	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300004463\|Ga0063356_103893894	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300004463\|Ga0063356_104907167	Not Available	575	Open in IMG/M
3300004463\|Ga0063356_104979933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	571	Open in IMG/M
3300005076\|Ga0069612_10123421	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	839	Open in IMG/M
3300005080\|Ga0069611_10081870	All Organisms → cellular organisms → Bacteria → Proteobacteria	1176	Open in IMG/M
3300005659\|Ga0073900_10016526	All Organisms → cellular organisms → Bacteria → Proteobacteria	3445	Open in IMG/M
3300005660\|Ga0073904_10091293	All Organisms → cellular organisms → Bacteria	1866	Open in IMG/M
3300005660\|Ga0073904_10266950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	980	Open in IMG/M
3300005660\|Ga0073904_10609988	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300005819\|Ga0078536_101215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	4377	Open in IMG/M
3300005982\|Ga0075156_10119185	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300005982\|Ga0075156_10249564	All Organisms → cellular organisms → Bacteria	937	Open in IMG/M
3300005982\|Ga0075156_10303623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5	833	Open in IMG/M
3300005989\|Ga0075154_10562204	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300006092\|Ga0082021_1094334	All Organisms → cellular organisms → Bacteria → Proteobacteria	1400	Open in IMG/M
3300007281\|Ga0104349_1058353	All Organisms → cellular organisms → Bacteria → Proteobacteria	515	Open in IMG/M
3300007790\|Ga0105679_10281739	All Organisms → cellular organisms → Bacteria → Proteobacteria	1022	Open in IMG/M
3300008070\|Ga0110938_1006692	All Organisms → cellular organisms → Bacteria → Proteobacteria	516	Open in IMG/M
3300008071\|Ga0110933_1089100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1005	Open in IMG/M
3300009070\|Ga0066256_1045756	Not Available	1338	Open in IMG/M
3300009196\|Ga0103745_10023708	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. LPFa	837	Open in IMG/M
3300009351\|Ga0115924_1065342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1107	Open in IMG/M
3300009501\|Ga0124838_10008560	All Organisms → cellular organisms → Bacteria → Proteobacteria	2581	Open in IMG/M
3300009501\|Ga0124838_10116671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1336	Open in IMG/M
3300009501\|Ga0124838_10127396	All Organisms → cellular organisms → Bacteria	1276	Open in IMG/M
3300009648\|Ga0116175_1018789	All Organisms → cellular organisms → Bacteria → Proteobacteria	2891	Open in IMG/M
3300009648\|Ga0116175_1091514	All Organisms → cellular organisms → Bacteria	1075	Open in IMG/M
3300009648\|Ga0116175_1214667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	637	Open in IMG/M
3300009653\|Ga0116169_1082273	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300009653\|Ga0116169_1099967	All Organisms → cellular organisms → Bacteria → Proteobacteria	1040	Open in IMG/M
3300009653\|Ga0116169_1206840	All Organisms → cellular organisms → Bacteria → Proteobacteria	655	Open in IMG/M
3300009653\|Ga0116169_1231533	All Organisms → cellular organisms → Bacteria → Proteobacteria	611	Open in IMG/M
3300009653\|Ga0116169_1314880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	510	Open in IMG/M
3300009653\|Ga0116169_1316307	All Organisms → cellular organisms → Bacteria → Proteobacteria	509	Open in IMG/M
3300009654\|Ga0116167_1076881	Not Available	1282	Open in IMG/M
3300009654\|Ga0116167_1106994	All Organisms → cellular organisms → Bacteria	1019	Open in IMG/M
3300009657\|Ga0116179_1199220	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300009657\|Ga0116179_1232572	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300009658\|Ga0116188_1260060	Not Available	604	Open in IMG/M
3300009663\|Ga0116181_1050402	All Organisms → cellular organisms → Bacteria → Proteobacteria	1881	Open in IMG/M
3300009663\|Ga0116181_1138953	All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerae bacterium RIFOXYA12_FULL_48_11	944	Open in IMG/M
3300009663\|Ga0116181_1159025	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300009664\|Ga0116146_1396284	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300009668\|Ga0116180_1071356	All Organisms → cellular organisms → Bacteria → Proteobacteria	1571	Open in IMG/M
3300009668\|Ga0116180_1113079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	1143	Open in IMG/M
3300009668\|Ga0116180_1120901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	1091	Open in IMG/M
3300009670\|Ga0116183_1189405	All Organisms → cellular organisms → Bacteria → Proteobacteria	969	Open in IMG/M
3300009685\|Ga0116142_10017269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4991	Open in IMG/M
3300009689\|Ga0116186_1292526	All Organisms → cellular organisms → Bacteria	695	Open in IMG/M
3300009704\|Ga0116145_1261599	All Organisms → cellular organisms → Bacteria → Proteobacteria	654	Open in IMG/M
3300009704\|Ga0116145_1261599	All Organisms → cellular organisms → Bacteria → Proteobacteria	654	Open in IMG/M
3300009711\|Ga0116166_1032561	All Organisms → cellular organisms → Bacteria → Proteobacteria	2506	Open in IMG/M
3300009712\|Ga0116165_1062446	All Organisms → cellular organisms → Bacteria → Proteobacteria	1484	Open in IMG/M
3300009712\|Ga0116165_1187278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	705	Open in IMG/M
3300009714\|Ga0116189_1288975	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	561	Open in IMG/M
3300009761\|Ga0116168_1120552	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300009769\|Ga0116184_10441688	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300009776\|Ga0116154_10407130	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Candidatus Viridilinea → Candidatus Viridilinea halotolerans	580	Open in IMG/M
3300009782\|Ga0116157_10651622	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300009870\|Ga0131092_10061673	All Organisms → cellular organisms → Bacteria	4852	Open in IMG/M
3300009870\|Ga0131092_10164153	All Organisms → cellular organisms → Bacteria → Proteobacteria	2406	Open in IMG/M
3300009870\|Ga0131092_10237067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1852	Open in IMG/M
3300009870\|Ga0131092_10257504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1746	Open in IMG/M
3300009870\|Ga0131092_10613179	All Organisms → cellular organisms → Bacteria → Proteobacteria	948	Open in IMG/M
3300009870\|Ga0131092_11038831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	659	Open in IMG/M
3300009870\|Ga0131092_11404587	All Organisms → cellular organisms → Bacteria → Proteobacteria	536	Open in IMG/M
3300009873\|Ga0131077_10513297	Not Available	1106	Open in IMG/M
3300010311\|Ga0116254_1107158	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300010327\|Ga0116246_10336671	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300010340\|Ga0116250_10081638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	2181	Open in IMG/M
3300010340\|Ga0116250_10179067	All Organisms → cellular organisms → Bacteria → Proteobacteria	1316	Open in IMG/M
3300010340\|Ga0116250_10337559	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300010340\|Ga0116250_10506841	All Organisms → cellular organisms → Bacteria → Proteobacteria	683	Open in IMG/M
3300010340\|Ga0116250_10530923	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300010340\|Ga0116250_10671450	All Organisms → cellular organisms → Bacteria → Proteobacteria	569	Open in IMG/M
3300010347\|Ga0116238_10477736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. W1-6	795	Open in IMG/M
3300010347\|Ga0116238_10982006	Not Available	506	Open in IMG/M
3300010348\|Ga0116255_10088147	All Organisms → cellular organisms → Bacteria → Proteobacteria	2475	Open in IMG/M
3300010352\|Ga0116247_10827966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter towneri	685	Open in IMG/M
3300010353\|Ga0116236_10518376	All Organisms → cellular organisms → Bacteria	993	Open in IMG/M
3300010353\|Ga0116236_11386593	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300010356\|Ga0116237_10713145	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300010357\|Ga0116249_11523616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	594	Open in IMG/M
3300010372\|Ga0114984_1041058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas caviae	1250	Open in IMG/M
3300011593\|Ga0122758_100236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42	14540	Open in IMG/M
3300012533\|Ga0138256_10652456	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	828	Open in IMG/M
3300014005\|Ga0121051_12761	Not Available	552	Open in IMG/M
3300014727\|Ga0121476_106161	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300014833\|Ga0119870_1181278	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300014961\|Ga0134526_1035431	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300018405\|Ga0194138_10071001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1498	Open in IMG/M
3300019213\|Ga0179950_1208719	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300019221\|Ga0179941_1018452	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300024051\|Ga0222423_1083825	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300025526\|Ga0208492_1041349	All Organisms → cellular organisms → Bacteria → Proteobacteria	935	Open in IMG/M
3300025587\|Ga0208938_1012980	All Organisms → cellular organisms → Bacteria → Proteobacteria	2869	Open in IMG/M
3300025589\|Ga0209409_1061671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1048	Open in IMG/M
3300025613\|Ga0208461_1060682	All Organisms → cellular organisms → Bacteria	1172	Open in IMG/M
3300025638\|Ga0208198_1091488	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300025691\|Ga0208826_1159636	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300025858\|Ga0209099_1229213	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300026284\|Ga0209792_1002728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7006	Open in IMG/M
3300027794\|Ga0209480_10131998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1117	Open in IMG/M
3300027959\|Ga0209477_1078885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1177	Open in IMG/M
3300028804\|Ga0268298_10088063	All Organisms → cellular organisms → Bacteria	1883	Open in IMG/M
3300033997\|Ga0310131_024250	All Organisms → cellular organisms → Bacteria	1876	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	88.62%
Environmental	Environmental	7.32%
Host-Associated	Host-Associated	4.06%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	82.11%
Terrestrial	Environmental → Terrestrial	4.88%
Plants	Host-Associated → Plants	3.25%
Built Environment	Engineered → Built Environment	3.25%
Aquatic	Environmental → Aquatic	2.44%
Bioremediation	Engineered → Bioremediation	2.44%
Arthropoda	Host-Associated → Arthropoda	0.81%
Biotransformation	Engineered → Biotransformation	0.81%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	47.15%
Activated Sludge	Engineered → Wastewater → Activated Sludge	16.26%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	13.82%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.25%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	3.25%
Freshwater	Environmental → Aquatic → Freshwater	2.44%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.44%
City	Engineered → Built Environment → City	2.44%
Soil	Environmental → Terrestrial → Soil	1.63%
Unclassified	Engineered → Wastewater → Unclassified	1.63%
Hydrocarbon	Engineered → Bioremediation → Hydrocarbon	1.63%
Oil Reservoir	Environmental → Terrestrial → Oil Reservoir	0.81%
Ant Dump	Host-Associated → Arthropoda → Ant Dump	0.81%
Unclassified	Engineered → Built Environment → Unclassified	0.81%
Terephthalate	Engineered → Bioremediation → Terephthalate	0.81%
Microbial Solubilization Of Coal	Engineered → Biotransformation → Microbial Solubilization Of Coal	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	47.15%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	16.26%
Biological Phosphorus Removal	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal	8.94%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	4.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.25%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.44%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	2.44%
Subway	Engineered → Built Environment → City → Subway	2.44%
Unclassified	Engineered → Wastewater → Unclassified → Unclassified	1.63%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified	1.63%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.81%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.81%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.81%
Loam	Environmental → Terrestrial → Soil → Loam	0.81%
Sand	Environmental → Terrestrial → Soil → Sand	0.81%
Unclassified	Environmental → Terrestrial → Oil Reservoir → Unclassified	0.81%
Unclassified	Host-Associated → Arthropoda → Ant Dump → Unclassified	0.81%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified	0.81%
Dissolved Organics (Aerobic)	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic)	0.81%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.81%
Wastewater	Engineered → Bioremediation → Terephthalate → Wastewater	0.81%
Unclassified	Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	47.15%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	16.26%
Bioreactor	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor	8.13%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	4.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.25%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.44%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	2.44%
Unclassified	Engineered → Built Environment → City → Subway → Unclassified	2.44%
Unclassified	Engineered → Wastewater → Unclassified → Unclassified → Unclassified	1.63%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified	1.63%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.81%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.81%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.81%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.81%
Unclassified	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified	0.81%
Unclassified	Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified	0.81%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified	0.81%
Unclassified	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Unclassified	0.81%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge	0.81%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.81%
Unclassified	Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified	0.81%
Unclassified	Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	47.15%
Wastewater Treatment	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment	8.13%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	6.50%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	4.06%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	4.06%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.25%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	2.44%
Wastewater Bioreactor	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor	1.63%
Wastewater	Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater	1.63%
Wastewater Bioreactor	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor	1.63%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.81%
Watersheds	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds	0.81%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.81%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.81%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.81%
Serpentinite Rock And Fluid	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid	0.81%
Petroleum Reservoir	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Petroleum Reservoir	0.81%
Ant Dump	Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump	0.81%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.81%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.81%
Wastewater Treatment Plant	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant	0.81%
Aeration Tank Of Activated Sludge Process	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process	0.81%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.81%
Wastewater	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater	0.81%
Wastewater Treatment	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Unclassified → Wastewater Treatment	0.81%
Wastewater Plasmid Pools	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools	0.81%
City Subway Metal/Plastic	Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic	0.81%
City Subway Metal	Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal	0.81%
City Subway Wood	Engineered → Built Environment → City → Subway → Unclassified → City Subway Wood	0.81%
Swimming Pool Sandfilter Backwash	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash	0.81%
Wastewater Bioreactor	Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor	0.81%
Hydrocarbon Resource Environments	Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments	0.81%
Wastewater Sludge	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2013843001	Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Morges-2007 (PGA)	Engineered	Open in IMG/M
3300000052	Coal bed methane well microbial communities from Alberta, Canada	Engineered	Open in IMG/M
3300001096	Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge	Engineered	Open in IMG/M
3300001592	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2:	Engineered	Open in IMG/M
3300002098	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome	Environmental	Open in IMG/M
3300002223	Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2	Environmental	Open in IMG/M
3300002596	Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10	Engineered	Open in IMG/M
3300003408	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan	Engineered	Open in IMG/M
3300003764	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_1/23/2012_ DNA	Engineered	Open in IMG/M
3300003767	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_10/4/2010_ DNA	Engineered	Open in IMG/M
3300003844	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor_6/25/2014_ DNA	Engineered	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005076	Combined Assembly of Gp0111534, Gp0111535, Gp0111536	Engineered	Open in IMG/M
3300005080	Combined Assembly of Gp0111534, Gp0111535, Gp0111536, Gp0111537, Gp0111539, Gp0111540, Gp0111541, Gp0111542, Gp0111543	Engineered	Open in IMG/M
3300005659	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit	Engineered	Open in IMG/M
3300005660	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate	Engineered	Open in IMG/M
3300005819	Microbial communities of produced water from Jiangsu Oil field in Yangzhou, China - Well_W15	Environmental	Open in IMG/M
3300005982	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA	Engineered	Open in IMG/M
3300005989	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA	Engineered	Open in IMG/M
3300006092	Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore	Engineered	Open in IMG/M
3300007281	Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B	Engineered	Open in IMG/M
3300007790	Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects	Environmental	Open in IMG/M
3300008070	Wastewater microbial communities from the hospital sewers in Singapore - Hospital 2	Engineered	Open in IMG/M
3300008071	Wastewater microbial communities from the domestic sewers in Singapore - Site 1	Engineered	Open in IMG/M
3300009070	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2)	Engineered	Open in IMG/M
3300009196	Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February	Environmental	Open in IMG/M
3300009351	Microbial communities from sand-filter backwash in Singapore swimming pools - PR-1	Engineered	Open in IMG/M
3300009501	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 2_5/28/2013_ DNA (PacBio error correction)	Engineered	Open in IMG/M
3300009648	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG	Engineered	Open in IMG/M
3300009653	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC130_MetaG	Engineered	Open in IMG/M
3300009654	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG	Engineered	Open in IMG/M
3300009657	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG	Engineered	Open in IMG/M
3300009658	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG	Engineered	Open in IMG/M
3300009663	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG	Engineered	Open in IMG/M
3300009664	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG	Engineered	Open in IMG/M
3300009668	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG	Engineered	Open in IMG/M
3300009670	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG	Engineered	Open in IMG/M
3300009685	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG	Engineered	Open in IMG/M
3300009689	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG	Engineered	Open in IMG/M
3300009704	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG	Engineered	Open in IMG/M
3300009711	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG	Engineered	Open in IMG/M
3300009712	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG	Engineered	Open in IMG/M
3300009714	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG	Engineered	Open in IMG/M
3300009761	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC129_MetaG	Engineered	Open in IMG/M
3300009769	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA5_MetaG	Engineered	Open in IMG/M
3300009776	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG	Engineered	Open in IMG/M
3300009782	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG	Engineered	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010311	AD_JPTRca	Engineered	Open in IMG/M
3300010327	AD_CNMVca	Engineered	Open in IMG/M
3300010340	AD_USOAca	Engineered	Open in IMG/M
3300010347	AD_JPHGca	Engineered	Open in IMG/M
3300010348	AD_HKYLca	Engineered	Open in IMG/M
3300010352	AD_JPHWca	Engineered	Open in IMG/M
3300010353	AD_USCAca	Engineered	Open in IMG/M
3300010356	AD_USDEca	Engineered	Open in IMG/M
3300010357	AD_USSTca	Engineered	Open in IMG/M
3300010372	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day1	Environmental	Open in IMG/M
3300011593	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway wood -P00382	Engineered	Open in IMG/M
3300012533	Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG	Engineered	Open in IMG/M
3300014005	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00768	Engineered	Open in IMG/M
3300014727	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00260	Engineered	Open in IMG/M
3300014833	Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - influent sewage	Engineered	Open in IMG/M
3300014961	Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1747	Engineered	Open in IMG/M
3300018405	Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T2_14	Environmental	Open in IMG/M
3300019213	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019221	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300024051	Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A0	Host-Associated	Open in IMG/M
3300025526	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Mar_CSW14AB (SPAdes)	Environmental	Open in IMG/M
3300025587	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025589	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025613	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025638	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025691	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025858	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300026284	Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA (SPAdes)	Engineered	Open in IMG/M
3300027794	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA (SPAdes)	Engineered	Open in IMG/M
3300027959	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes)	Engineered	Open in IMG/M
3300028804	Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt	Engineered	Open in IMG/M
3300033997	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-FT7-sol	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
PLMO_259200	2013843001	Wastewater Plasmid Pools	ARRMRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE
Draft_0615274	3300000052	Hydrocarbon Resource Environments	RRRRVGLNAGLDPKAKRKRPDLDKGAAHEKALGHGSGAALQE*
JGI11944J13513_10540061	3300001096	Wastewater Bioreactor	VGLNAELDPKAKKERPDLEKGAAHAKALGHRSGAALQKR*
Draft_100285066	3300001592	Hydrocarbon Resource Environments	MRVRLTAELDPKAKRERPDLDKGAAHEKALGHGSGAALQK*
Draft_103522031	3300001592	Hydrocarbon Resource Environments	RVGLSAELDPKAKRERPDLEKGAAHEKPLRHRSDATLQE*
JGI24219J26650_10057201	3300002098	Lentic	LTAELDPKAKRERPALTTCAAQEKALGHGSGAALQE*
C687J26845_100014129	3300002223	Soil	VVGCDEQLDPKAKRGRPDLKTGAAQEKAPRHGSGATLQK*
draft_13534511	3300002596	Hydrocarbon Resource Environments	RRRRVGLSAGLDPKAKRERPDLKKGAAHEKALRHGSGAALQ*
JGI26524J50256_100248314	3300003408	Wastewater Bioreactor	MRVRLSAELDPKAKRERPALKKGAAHEKALGHGSGAALQE*
Ga0056910_10060792	3300003764	Wastewater Treatment	MRVRLTAELDPKAKRRRPDLDKGAAHQKALGHESGAVLRE*
Ga0056910_10060793	3300003764	Wastewater Treatment	MRVRLTAELDPKAKRERPALKKGAAHEKPLGHESGAALQEG*
Ga0056910_10075573	3300003764	Wastewater Treatment	RMRVRLTAELDPKAKRRRPDLDKGAAHEKALGHGSGAALQK*
Ga0056910_10239452	3300003764	Wastewater Treatment	MRVRLTAKLDPKAKRKRPDLDKGAAHEKALGHGSGAVLQE*
Ga0056908_10045106	3300003767	Wastewater Treatment	MRVRLTAELDPKAKRKRPDRDKGAAHEKALGHESGAALQEG*
Ga0056908_10048726	3300003767	Wastewater Treatment	MRVRLTAELDPKAKRVRPDLKTGATHEKALRHGSGAALQE*
Ga0056914_100248954	3300003844	Wastewater Treatment	MRVRLTAELDPKAKRERPALKMCAAHEKALGHGSGAALQEG*
Ga0063356_1021246402	3300004463	Arabidopsis Thaliana Rhizosphere	MRVRLSAELDPKAKREHPEVETGAADAKALRHGSGAALQER*
Ga0063356_1038938942	3300004463	Arabidopsis Thaliana Rhizosphere	RRRVGLNAELDPKAKKGRPDREKGAAHAKALGHRSGTALQE*
Ga0063356_1049071671	3300004463	Arabidopsis Thaliana Rhizosphere	AARRRRVGLNAELDPKAKKERPALEKGAAHSKALGHRSGTALQE**
Ga0063356_1049799331	3300004463	Arabidopsis Thaliana Rhizosphere	MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGEVLQE*
Ga0069612_101234211	3300005076	Wastewater Bioreactor	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG*
Ga0069611_100818701	3300005080	Wastewater Bioreactor	MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQER*
Ga0073900_100165267	3300005659	Activated Sludge	MRVRLTAELDPKAKRGRPDLDKGAAHEKALGHESGAALQEG*
Ga0073904_100912935	3300005660	Activated Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAVLQE*
Ga0073904_102669501	3300005660	Activated Sludge	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQA*
Ga0073904_106099882	3300005660	Activated Sludge	MRVRLTAELDPKAKRERPDLDKGAAHEKALGHGSDAALQEG*
Ga0078536_1012156	3300005819	Petroleum Reservoir	AKLDPKAKRKRPDLDKGAAHQKALGHESGAALQE*
Ga0075156_101191852	3300005982	Wastewater Effluent	LNAELDPKAKRERPDLDKGAAHAKALGHESGAALQE*
Ga0075156_102495642	3300005982	Wastewater Effluent	VVCPCFSGLDPKAKRERPDLNKGAAHEKALGHESGAALQE*
Ga0075156_103036232	3300005982	Wastewater Effluent	MRVRLTAELDPKAKRERPDLKMCAAQEKPLGHESGAALQE*
Ga0075154_105622041	3300005989	Wastewater Effluent	RRVGLTAMLDPKAERERPDLKTGAAHEKALRHGSDAALQE*
Ga0082021_10943342	3300006092	Wastewater Treatment Plant	MRVRLTAELDPKAKRKRPDLDKGAAHQKALGHESGAALQE*
Ga0104349_10583531	3300007281	Aeration Tank Of Activated Sludge Process	RRVRLNAELDPKAKKERPDLKKGAAHEKALGHRSGAALQE*
Ga0105679_102817392	3300007790	Soil	AARRRRVGLSAELDPKAKRERPDLETGTTHEKALGHKSGAALQE*
Ga0110938_10066921	3300008070	Wastewater	MRVRLTAELDPKAKRERPDLKTGAAHEKALGHGSGAALQ
Ga0110933_10891002	3300008071	Wastewater	MRVRLTAELDPKAKRERPDLDKGAAHEKALGHGSG
Ga0066256_10457563	3300009070	Wastewater Bioreactor	LSAELDPKAKKGRPDLETGAAHAKALGHRRGAALQE*
Ga0103745_100237082	3300009196	Wastewater Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQK*
Ga0115924_10653421	3300009351	Swimming Pool Sandfilter Backwash	MRVRLTAELDPKANRERPDLKTGAAHEKALGHGSGAALQK*
Ga0124838_100085601	3300009501	Wastewater Treatment	MRVRLTAELDPKAKRERPDLKTGAAHEKALGLGSGATLQ
Ga0124838_101166711	3300009501	Wastewater Treatment	MRVRLTAELDPKAKRERPDLKTGAAHEKALGLGSSGAAQ
Ga0124838_101273962	3300009501	Wastewater Treatment	LNAKLDPKAKKGRPDWEKGAAHEQALGHRSGAALQER*
Ga0116175_10187892	3300009648	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAVLQE*
Ga0116175_10915142	3300009648	Anaerobic Digestor Sludge	LSAGLDPKAKRERPDLDKGAAHEKALGHESGAALQEG*
Ga0116175_12146671	3300009648	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQDG*
Ga0116169_10822731	3300009653	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQE*
Ga0116169_10999672	3300009653	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPDLNKGAAHEKPLGHESGAALQE*
Ga0116169_12068402	3300009653	Anaerobic Digestor Sludge	AARRMRVRLSAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE*
Ga0116169_12315331	3300009653	Anaerobic Digestor Sludge	RLTAGLDPKAKRGRTDLKKGAAHEKALGHESGAALQE*
Ga0116169_13148801	3300009653	Anaerobic Digestor Sludge	LIAELDPKAKRERPALKKGAAHEKALGHESGAALQE
Ga0116169_13163071	3300009653	Anaerobic Digestor Sludge	KPVRLSAELDPKAKKGRPDLKTGTTHAKALGHGSGAALQEG*
Ga0116167_10768812	3300009654	Anaerobic Digestor Sludge	LNAELDPKAKKERPDLEKGAAHAKALGHRSGAALQE*
Ga0116167_11069941	3300009654	Anaerobic Digestor Sludge	AARRMRVRLTAELDPKAKRERPALKTGAAQEKALGHGSGAALQE*
Ga0116179_11992202	3300009657	Anaerobic Digestor Sludge	MRVGLTAELDPKAKRERTDLDQGAAHEKALDHESGAALQEG*
Ga0116179_12325721	3300009657	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHGSGAALQE*
Ga0116188_12600602	3300009658	Anaerobic Digestor Sludge	ARRRRVGLSAELDPKAKKGRPDLETGAAHAKALGHRRGAALQE*
Ga0116181_10504023	3300009663	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPDLKKGAAHQKALGHGSGAALRE*
Ga0116181_11389533	3300009663	Anaerobic Digestor Sludge	RRVGLNAGLDPKAKRERPDLDQGAAHEKALGHESGAALQE*
Ga0116181_11590251	3300009663	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAQEKPLGHGSGAALQEG*
Ga0116146_13962842	3300009664	Anaerobic Digestor Sludge	MRVGLNAGLDPKAKRERPDLKKGAAHEKALRHGSGAALQ*
Ga0116180_10713563	3300009668	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALDKGAAQEKPLGHGSGAALQEG*
Ga0116180_11130792	3300009668	Anaerobic Digestor Sludge	LTAELDPKAKRERLDLKTGAAQEKALRHESGEALQE*
Ga0116180_11209012	3300009668	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRKRPDWNKGVAHEKALGHESGAALQE*
Ga0116183_11894051	3300009670	Anaerobic Digestor Sludge	AELDPKAKKGRPDLKTGTTHAKALGHGSGAALQE*
Ga0116142_100172697	3300009685	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE*
Ga0116186_12925261	3300009689	Anaerobic Digestor Sludge	LNAELDPKTKKKRPDLDKGAAHEKALGHESGAALQE*
Ga0116145_12615991	3300009704	Anaerobic Digestor Sludge	MRVGLNAGLDPKANRERPDLKTGAAHEKELGHGSGAALQEG*
Ga0116145_12615992	3300009704	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAA
Ga0116166_10325616	3300009711	Anaerobic Digestor Sludge	GLSAELDPKAKKGRPDLETGAAHAKALGHRRGAALQE*
Ga0116165_10624463	3300009712	Anaerobic Digestor Sludge	RRRRVGLSAKLDPKARRERPALKKGAAHEKALGQGSGAVLQE*
Ga0116165_11872782	3300009712	Anaerobic Digestor Sludge	VRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE*
Ga0116189_12889751	3300009714	Anaerobic Digestor Sludge	RLTAELDPKAKRERPALKKGAAHEKPLGHGSGAALQEG*
Ga0116168_11205521	3300009761	Anaerobic Digestor Sludge	VRLSAELDPKAKRGRPALKTCAAHEKALGHGSGAALQE*
Ga0116184_104416882	3300009769	Anaerobic Digestor Sludge	IAELDPKAKRERPDLDQGAAHEKALGHESGAALQE*
Ga0116154_104071301	3300009776	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAALQE*
Ga0116157_106516221	3300009782	Anaerobic Digestor Sludge	LNAGLDPKAKRERPDLDKGAAHEKALGHESGAALQK*
Ga0131092_100616736	3300009870	Activated Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQE*
Ga0131092_101641533	3300009870	Activated Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE*
Ga0131092_102370675	3300009870	Activated Sludge	AARRRRVGLNAELDPKAKRERPAREKGAAQAKALGHRSGAALQE*
Ga0131092_102575042	3300009870	Activated Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHESGAALQEG*
Ga0131092_106131791	3300009870	Activated Sludge	LNAGLDPKAKRERPDLDKGAAHEKALGHESGAALQKW*
Ga0131092_110388312	3300009870	Activated Sludge	MRVRLTAELDPKAKRKRPDWDKGAAHEKPLGHESGAALQE*
Ga0131092_114045871	3300009870	Activated Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAVLQE*
Ga0131077_105132971	3300009873	Wastewater	GCDEMLDTMAKRERPDLETGATHEKAQRHGSGAAPQER*
Ga0116254_11071582	3300010311	Anaerobic Digestor Sludge	LNAELDPKAKKGRSDLEKGAAHAKALGHRSGAALQER*
Ga0116246_103366711	3300010327	Anaerobic Digestor Sludge	AELDPKAKRERPALKMCAAQEKPLGHGSGAALQEG*
Ga0116250_100816385	3300010340	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRKRPDWDKGAAHQKALGHGSGAALQE*
Ga0116250_101790671	3300010340	Anaerobic Digestor Sludge	TAELDPKAKRERPTLKKGAAHEKALGQGSGAVLQE*
Ga0116250_103375593	3300010340	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPTLKKGAAHEKALGQGSGAVLQE*
Ga0116250_105068411	3300010340	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPDLNKGAAHEKALGHENGAVLQE*
Ga0116250_105309231	3300010340	Anaerobic Digestor Sludge	MRVRLTAELDPKANKKRPDLDKGAAHEKALDHESGAVLQK*
Ga0116250_106714502	3300010340	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRRRPDLDKGAAHEKALGHGSGAALQE*
Ga0116238_104777362	3300010347	Anaerobic Digestor Sludge	RRRVGSNAELDPKAKKERPALERGAAHEKALGHRSDAALQER*
Ga0116238_109820061	3300010347	Anaerobic Digestor Sludge	MRVGLNAGLDPKANRERPDLKTGAAHEKALGHGSGAALQK*
Ga0116255_100881475	3300010348	Anaerobic Digestor Sludge	RRRVGLNAELDPKAKRERPDLQKGAAHEKALGHESGAAQQE*
Ga0116247_108279661	3300010352	Anaerobic Digestor Sludge	RLTAELDPKAKRERPDLNKGAAHEKALGHESGAALQE*
Ga0116236_105183761	3300010353	Anaerobic Digestor Sludge	RQNSRDHNRHTSLNAGLDPKAKRERPDLNKGAAHEKALGHESGAALQE*
Ga0116236_113865931	3300010353	Anaerobic Digestor Sludge	ARRRRVGLNAELDPKAKRERPELKNSAAHEKVLGHESGAAPQE*
Ga0116237_107131451	3300010356	Anaerobic Digestor Sludge	RMRVRLTAELDPKAKRVRPALKTCAAHEKALGHGSGAALQE*
Ga0116249_115236161	3300010357	Anaerobic Digestor Sludge	NVVCPCFSGLDPKAKRERPDLNKGAAHEKALGHESGAALQEG*
Ga0114984_10410583	3300010372	Deep Subsurface	LNAGLDPKAKRERPDVDKGAAHEKALGHESGAALQE*
Ga0122758_10023616	3300011593	City Subway Wood	MRVRLTAELDPKAKRERPDMDKGAAHEKALGHESGAALQE*
Ga0138256_106524561	3300012533	Active Sludge	NAGLDPKAKRVRPALKTCAAHEKPLGHESGAALQE*
Ga0121051_127611	3300014005	City Subway Metal	LSAELDPKAKRKRPDLDKGAAHEKALGHESGAALQE
Ga0121476_1061612	3300014727	City Subway Metal/Plastic	GLNAELDPKAKRERTDLDQGAAHEKALGHESGAALQE*
Ga0119870_11812781	3300014833	Activated Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHKSGAVLQK*
Ga0134526_10354311	3300014961	Wastewater	PVRLTAELDPKAKRERLDLKTHATHENALRHGSGEALQE*
Ga0194138_100710011	3300018405	Watersheds	CFLRDPKAKRGRTDLKKGAAHEKALGHESGAALQE
Ga0179950_12087192	3300019213	Anaerobic Digestor Sludge	ARRRRVGLSAELDPKAKRERLDLRTGATHEKALRHGSGAALQE
Ga0179941_10184521	3300019221	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKPLGHGSDAAL
Ga0222423_10838252	3300024051	Ant Dump	RRRVGLSAELDPKAKRERPDLEKGAAHEKTLCHGSGAALQE
Ga0208492_10413492	3300025526	Serpentinite Rock And Fluid	MRVRLTAELDPKANRERPDLKTGAAHEKALGHGSGAALQK
Ga0208938_10129805	3300025587	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAVLQE
Ga0209409_10616712	3300025589	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGHGSGAALQE
Ga0208461_10606821	3300025613	Anaerobic Digestor Sludge	PVRLSAELDPKAKRGRPALKTCAAHEKALGHGSGAALQE
Ga0208198_10914881	3300025638	Anaerobic Digestor Sludge	LNAELDPKAKKGRSDLEKGAAHAKALGHRSGAALQER
Ga0208826_11596362	3300025691	Anaerobic Digestor Sludge	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHGSGAALQE
Ga0209099_12292132	3300025858	Anaerobic Digestor Sludge	LNAELDPKAKRERPDLDKGAAHEKALGHGSGAALQEG
Ga0209792_10027283	3300026284	Wastewater Treatment	MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHESGAALQEG
Ga0209480_101319982	3300027794	Wastewater Effluent	MRVRLTAELDPKAKRERPALKKGAAHEKALGHESGAALQEG
Ga0209477_10788852	3300027959	Activated Sludge	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG
Ga0268298_100880633	3300028804	Activated Sludge	MRVRLTAELDPKAKRERPALKKGAAHEKALGQGSGAVLQE
Ga0310131_024250_4_126	3300033997	Fracking Water	MRVRLTAELDPKAKRERPALKKGAAQEKALGHESGAALQE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F069722

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences