3300003767: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_10/4/2010_ DNA

Overview

Basic Information

• IMG/M Taxon OID: 3300003767
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0055735 | Gp0103138 | Ga0056908
• Sample Name: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_10/4/2010_ DNA
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 134049793
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.076217
  • Long. (^o): -89.411742
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y
F097376	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0056908_1004510	All Organisms → cellular organisms → Bacteria → Proteobacteria	3220
Ga0056908_1004872	All Organisms → cellular organisms → Bacteria → Proteobacteria	3013
Ga0056908_1014229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1191

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0056908_1004510	Ga0056908_10045106	F069722	MRVRLTAELDPKAKRKRPDRDKGAAHEKALGHESGAALQEG*
Ga0056908_1004872	Ga0056908_10048726	F069722	MRVRLTAELDPKAKRVRPDLKTGATHEKALRHGSGAALQE*
Ga0056908_1014229	Ga0056908_10142292	F097376	MKKAVTPKKNKTADDVVTQKKQERKTGPVELDLEELKKVSGGLPKGGWKPV*