Basic Information | |
---|---|
IMG/M Taxon OID | 3300011593 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118444 | Gp0136074 | Ga0122758 |
Sample Name | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway wood -P00382 |
Sequencing Status | Permanent Draft |
Sequencing Center | Weill Cornell Medical College |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 29083962 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
Type | Engineered |
Taxonomy | Engineered → Built Environment → City → Subway → Unclassified → City Subway Wood → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA:New York City | |||||||
Coordinates | Lat. (o) | 40.68 | Long. (o) | -73.96 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069722 | Metagenome / Metatranscriptome | 123 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0122758_100236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42 | 14540 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0122758_100236 | Ga0122758_10023616 | F069722 | MRVRLTAELDPKAKRERPDMDKGAAHEKALGHESGAALQE* |
⦗Top⦘ |