3300005076: Combined Assembly of Gp0111534, Gp0111535, Gp0111536

Overview

Basic Information

• IMG/M Taxon OID: 3300005076
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114457 | Gp0111534 | Ga0069612
• Sample Name: Combined Assembly of Gp0111534, Gp0111535, Gp0111536
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Michigan
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 543798130
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor → Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Unclassified

Location Information

• Location: Ann Arbor, MI
• Coordinates
  • Lat. (^o): 42.293023
  • Long. (^o): -83.713393
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0069612_10123421	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	839

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0069612_10123421	Ga0069612_101234211	F069722	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG*