NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026284

3300026284: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026284 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055735 | Gp0103133 | Ga0209792
Sample NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_6/14/2005_ DNA (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size228922633
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Unclassified → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069722Metagenome / Metatranscriptome123Y
F091594Metagenome / Metatranscriptome107Y
F097376Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209792_1000394All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae33702Open in IMG/M
Ga0209792_1002728All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7006Open in IMG/M
Ga0209792_1077428Not Available608Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209792_1000394Ga0209792_100039416F091594MSENGITHYCLGNGAPKCDGCKQEKNWQALNQMPGTLRKPLQAQAQRIDDTDCILSGRPWYVGA
Ga0209792_1002728Ga0209792_10027283F069722MRVRLTAELDPKAKRKRPDLDKGAAHEKALGHESGAALQEG
Ga0209792_1077428Ga0209792_10774282F097376MKKAVAPKKKKTAADVVAEKKPAKSGPVVLDLDDLKKVAGGLPKGGWDRK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.