Basic Information | |
---|---|
IMG/M Taxon OID | 3300003408 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095076 | Ga0041897 |
Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 284901232 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 6 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Type | Engineered |
Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | South Africa: Cape Town | |||||||
Coordinates | Lat. (o) | -33.936637 | Long. (o) | 18.478905 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006009 | Metagenome / Metatranscriptome | 384 | Y |
F021521 | Metagenome / Metatranscriptome | 218 | Y |
F025775 | Metagenome | 200 | Y |
F064866 | Metagenome / Metatranscriptome | 128 | Y |
F065495 | Metagenome / Metatranscriptome | 127 | Y |
F069722 | Metagenome / Metatranscriptome | 123 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI26524J50256_1000001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 652222 | Open in IMG/M |
JGI26524J50256_1000146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 119024 | Open in IMG/M |
JGI26524J50256_1002483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 10878 | Open in IMG/M |
JGI26524J50256_1003382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 7692 | Open in IMG/M |
JGI26524J50256_1025892 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
JGI26524J50256_1059722 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 830 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI26524J50256_1000001 | JGI26524J50256_100000180 | F064866 | MKAPYLCWLVSISALLYPYISSAQWDENNSLGRYSYPIFAVTGKQQFTGTAFFYRSGDTTFLVSNYHAIKGMSPLKKTITFNSDTLYLKYSVKDSGGSKVLPIDVSDAAIGETEIFSMVDRIDLLKIPMELPGDADIHFINDLVDPAYFNAVPEEVVVFGFPTGPGNIPPFYSQQQILAGQVNQQGFADYDASLKVNFPGSSDSARAILSGTARYYYFIKPYAAQGYSGAPVFGKFRTAEGQVIYRFSGVIFAGQPMTRQTWAIKGSVALQYLKGEL* |
JGI26524J50256_1000146 | JGI26524J50256_100014647 | F021521 | MAGYSHRTATTIYLAAFRPWGGSTGAGRVRPAGAKIQAQGIFPQKKAL* |
JGI26524J50256_1002483 | JGI26524J50256_100248314 | F069722 | MRVRLSAELDPKAKRERPALKKGAAHEKALGHGSGAALQE* |
JGI26524J50256_1003382 | JGI26524J50256_10033821 | F025775 | NFNGARTMKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
JGI26524J50256_1025892 | JGI26524J50256_10258922 | F006009 | MDTEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG* |
JGI26524J50256_1059722 | JGI26524J50256_10597222 | F065495 | MLHRLTVGHLDVAAVERRQTVPVKALEMDVVHRLLGELGEKDDDGDVTLGGCKVKFENGAVSCLWMGGRANRVAEEFALRMHRETGCVIADVGGYRVIEPDELTGLTGQASGSKPGAVRTR* |
⦗Top⦘ |