3300024051: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A0

Overview

Basic Information

• IMG/M Taxon OID: 3300024051
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121620 | Gp0224308 | Ga0222423
• Sample Name: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A0
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 237192996
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
• Type: Host-Associated
• Taxonomy: Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.0758
  • Long. (^o): -89.4125
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y
F099558	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0222423_1047961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	898
Ga0222423_1083825	All Organisms → cellular organisms → Bacteria	591

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0222423_1047961	Ga0222423_10479612	F099558	MSYSSQSDSLVPSITRRDRSIIGRLVSAVLSQWPERTRGSPPLDNYLRRDIGLEPIDHRSNYWDHQ
Ga0222423_1083825	Ga0222423_10838252	F069722	RRRVGLSAELDPKAKRERPDLEKGAAHEKTLCHGSGAALQE