| Basic Information | |
|---|---|
| Family ID | F002525 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 552 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVG |
| Number of Associated Samples | 243 |
| Number of Associated Scaffolds | 549 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.82 % |
| % of genes near scaffold ends (potentially truncated) | 54.17 % |
| % of genes from short scaffolds (< 2000 bps) | 69.02 % |
| Associated GOLD sequencing projects | 226 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.268 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (24.457 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.449 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.551 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 549 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 2.91 |
| PF02371 | Transposase_20 | 1.64 |
| PF08241 | Methyltransf_11 | 1.46 |
| PF14329 | DUF4386 | 1.46 |
| PF00990 | GGDEF | 1.28 |
| PF13676 | TIR_2 | 1.09 |
| PF00331 | Glyco_hydro_10 | 0.91 |
| PF13651 | EcoRI_methylase | 0.91 |
| PF00293 | NUDIX | 0.91 |
| PF09516 | RE_CfrBI | 0.73 |
| PF01636 | APH | 0.55 |
| PF01844 | HNH | 0.55 |
| PF13470 | PIN_3 | 0.55 |
| PF05015 | HigB-like_toxin | 0.55 |
| PF14319 | Zn_Tnp_IS91 | 0.55 |
| PF13302 | Acetyltransf_3 | 0.55 |
| PF13649 | Methyltransf_25 | 0.55 |
| PF05423 | Mycobact_memb | 0.55 |
| PF00656 | Peptidase_C14 | 0.55 |
| PF02517 | Rce1-like | 0.55 |
| PF13751 | DDE_Tnp_1_6 | 0.55 |
| PF02384 | N6_Mtase | 0.36 |
| PF14338 | Mrr_N | 0.36 |
| PF01909 | NTP_transf_2 | 0.36 |
| PF00005 | ABC_tran | 0.36 |
| PF14137 | DUF4304 | 0.36 |
| PF10881 | DUF2726 | 0.36 |
| PF12900 | Pyridox_ox_2 | 0.36 |
| PF01872 | RibD_C | 0.36 |
| PF01545 | Cation_efflux | 0.36 |
| PF00400 | WD40 | 0.36 |
| PF00150 | Cellulase | 0.36 |
| PF13671 | AAA_33 | 0.36 |
| PF02452 | PemK_toxin | 0.36 |
| PF14534 | DUF4440 | 0.36 |
| PF11185 | DUF2971 | 0.36 |
| PF04471 | Mrr_cat | 0.36 |
| PF13489 | Methyltransf_23 | 0.36 |
| PF03483 | B3_4 | 0.36 |
| PF13646 | HEAT_2 | 0.36 |
| PF13588 | HSDR_N_2 | 0.36 |
| PF03992 | ABM | 0.36 |
| PF01381 | HTH_3 | 0.36 |
| PF13495 | Phage_int_SAM_4 | 0.36 |
| PF03781 | FGE-sulfatase | 0.36 |
| PF10107 | Endonuc_Holl | 0.36 |
| PF08818 | DUF1801 | 0.36 |
| PF05066 | HARE-HTH | 0.36 |
| PF02086 | MethyltransfD12 | 0.36 |
| PF05656 | DUF805 | 0.36 |
| PF01936 | NYN | 0.36 |
| PF13560 | HTH_31 | 0.36 |
| PF07676 | PD40 | 0.36 |
| PF03852 | Vsr | 0.36 |
| PF00069 | Pkinase | 0.36 |
| PF10518 | TAT_signal | 0.36 |
| PF07669 | Eco57I | 0.36 |
| PF00196 | GerE | 0.18 |
| PF06224 | HTH_42 | 0.18 |
| PF05368 | NmrA | 0.18 |
| PF03795 | YCII | 0.18 |
| PF13828 | DUF4190 | 0.18 |
| PF12680 | SnoaL_2 | 0.18 |
| PF09520 | RE_TdeIII | 0.18 |
| PF13020 | NOV_C | 0.18 |
| PF01209 | Ubie_methyltran | 0.18 |
| PF02080 | TrkA_C | 0.18 |
| PF00118 | Cpn60_TCP1 | 0.18 |
| PF00145 | DNA_methylase | 0.18 |
| PF07828 | PA-IL | 0.18 |
| PF00211 | Guanylate_cyc | 0.18 |
| PF12870 | DUF4878 | 0.18 |
| PF14279 | HNH_5 | 0.18 |
| PF02668 | TauD | 0.18 |
| PF08867 | FRG | 0.18 |
| PF01590 | GAF | 0.18 |
| PF01202 | SKI | 0.18 |
| PF03764 | EFG_IV | 0.18 |
| PF13673 | Acetyltransf_10 | 0.18 |
| PF13231 | PMT_2 | 0.18 |
| PF07927 | HicA_toxin | 0.18 |
| PF03683 | UPF0175 | 0.18 |
| PF01370 | Epimerase | 0.18 |
| PF08722 | Tn7_TnsA-like_N | 0.18 |
| PF08282 | Hydrolase_3 | 0.18 |
| PF01420 | Methylase_S | 0.18 |
| PF00756 | Esterase | 0.18 |
| PF13847 | Methyltransf_31 | 0.18 |
| PF03703 | bPH_2 | 0.18 |
| PF00078 | RVT_1 | 0.18 |
| PF14062 | DUF4253 | 0.18 |
| PF00571 | CBS | 0.18 |
| PF03681 | Obsolete Pfam Family | 0.18 |
| PF04655 | APH_6_hur | 0.18 |
| PF00271 | Helicase_C | 0.18 |
| PF01477 | PLAT | 0.18 |
| PF13377 | Peripla_BP_3 | 0.18 |
| PF07661 | MORN_2 | 0.18 |
| PF03243 | MerB | 0.18 |
| PF13175 | AAA_15 | 0.18 |
| PF12773 | DZR | 0.18 |
| PF07510 | DUF1524 | 0.18 |
| PF11903 | ParD_like | 0.18 |
| PF13683 | rve_3 | 0.18 |
| PF12697 | Abhydrolase_6 | 0.18 |
| PF12867 | DinB_2 | 0.18 |
| PF07693 | KAP_NTPase | 0.18 |
| PF00719 | Pyrophosphatase | 0.18 |
| PF06421 | LepA_C | 0.18 |
| PF00962 | A_deaminase | 0.18 |
| PF00583 | Acetyltransf_1 | 0.18 |
| PF08239 | SH3_3 | 0.18 |
| PF12695 | Abhydrolase_5 | 0.18 |
| PF04167 | DUF402 | 0.18 |
| PF14076 | DUF4258 | 0.18 |
| PF00903 | Glyoxalase | 0.18 |
| PF11611 | DUF4352 | 0.18 |
| PF04480 | DUF559 | 0.18 |
| PF02037 | SAP | 0.18 |
| PF13279 | 4HBT_2 | 0.18 |
| PF04986 | Y2_Tnp | 0.18 |
| PF12686 | DUF3800 | 0.18 |
| PF14487 | DarT | 0.18 |
| PF13659 | Obsolete Pfam Family | 0.18 |
| PF03598 | CdhC | 0.18 |
| PF13400 | Tad | 0.18 |
| PF03631 | Virul_fac_BrkB | 0.18 |
| PF05076 | SUFU | 0.18 |
| PF13181 | TPR_8 | 0.18 |
| PF12654 | DUF3786 | 0.18 |
| PF00498 | FHA | 0.18 |
| PF12172 | DUF35_N | 0.18 |
| PF14229 | DUF4332 | 0.18 |
| PF13245 | AAA_19 | 0.18 |
| PF13442 | Cytochrome_CBB3 | 0.18 |
| PF00795 | CN_hydrolase | 0.18 |
| PF11196 | DUF2834 | 0.18 |
| PF05598 | DUF772 | 0.18 |
| PF05729 | NACHT | 0.18 |
| PF01243 | Putative_PNPOx | 0.18 |
| PF01156 | IU_nuc_hydro | 0.18 |
| PF06445 | GyrI-like | 0.18 |
| PF01609 | DDE_Tnp_1 | 0.18 |
| PF04191 | PEMT | 0.18 |
| PF03235 | DUF262 | 0.18 |
| PF06271 | RDD | 0.18 |
| PF00133 | tRNA-synt_1 | 0.18 |
| PF00160 | Pro_isomerase | 0.18 |
| PF08020 | DUF1706 | 0.18 |
| PF07731 | Cu-oxidase_2 | 0.18 |
| PF13414 | TPR_11 | 0.18 |
| PF07914 | DUF1679 | 0.18 |
| PF01551 | Peptidase_M23 | 0.18 |
| PF07876 | Dabb | 0.18 |
| PF14024 | DUF4240 | 0.18 |
| PF13427 | DUF4111 | 0.18 |
| PF13508 | Acetyltransf_7 | 0.18 |
| PF05099 | TerB | 0.18 |
| PF14280 | DUF4365 | 0.18 |
| PF13240 | zinc_ribbon_2 | 0.18 |
| PF05257 | CHAP | 0.18 |
| PF12844 | HTH_19 | 0.18 |
| PF04545 | Sigma70_r4 | 0.18 |
| PF02126 | PTE | 0.18 |
| PF10604 | Polyketide_cyc2 | 0.18 |
| PF13419 | HAD_2 | 0.18 |
| COG ID | Name | Functional Category | % Frequency in 549 Family Scaffolds |
|---|---|---|---|
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.91 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.91 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.64 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.46 |
| COG3693 | Endo-1,4-beta-xylanase, GH35 family | Carbohydrate transport and metabolism [G] | 0.91 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.55 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.55 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.55 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.36 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.36 |
| COG3727 | G:T-mismatch repair DNA endonuclease Vsr, very short patch repair protein | Replication, recombination and repair [L] | 0.36 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.36 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.36 |
| COG3343 | DNA-directed RNA polymerase, delta subunit | Transcription [K] | 0.36 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.36 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.36 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.36 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.36 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.36 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.36 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.36 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.36 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.36 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.36 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.18 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.18 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.18 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.18 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.18 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.18 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.18 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.18 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.18 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.18 |
| COG4928 | Predicted P-loop ATPase, KAP-like | General function prediction only [R] | 0.18 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.18 |
| COG4283 | Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain | General function prediction only [R] | 0.18 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.18 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.18 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.18 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.18 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.18 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
| COG0481 | Translation elongation factor EF-4, membrane-bound GTPase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.18 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.18 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.18 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.18 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.18 |
| COG1614 | CO dehydrogenase/acetyl-CoA synthase beta subunit | Energy production and conversion [C] | 0.18 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.18 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.18 |
| COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.18 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.18 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.18 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.18 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.18 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.18 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.18 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.18 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.18 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.18 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.18 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.54 % |
| Unclassified | root | N/A | 22.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000227|TB_AS07_7DRAFT_10032251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1648 | Open in IMG/M |
| 3300000227|TB_AS07_7DRAFT_10040314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1304 | Open in IMG/M |
| 3300000227|TB_AS07_7DRAFT_10091399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 562 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10002326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 9834 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10017644 | Not Available | 3179 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10019319 | All Organisms → cellular organisms → Bacteria | 2993 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10069052 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. CLA17 | 1197 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10072927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1141 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10074136 | Not Available | 1126 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10087603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 976 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10097034 | Not Available | 894 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10097265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 892 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10105368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 833 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10118368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 755 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10126510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 716 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10130119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 699 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10131704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 693 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10171445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 562 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10186800 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10189681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 521 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10030251 | Not Available | 2679 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10035569 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10038962 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10058024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii | 1715 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10093360 | Not Available | 1176 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10151479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 789 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10162707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 745 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10166234 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10167377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 728 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10186453 | Not Available | 669 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10246004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10062006 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10075041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1315 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10133000 | Not Available | 860 | Open in IMG/M |
| 3300000232|TB_PC08_64DRAFT_1088053 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1007459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4494 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1043827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1045592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1043 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1050117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 954 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10025145 | All Organisms → cellular organisms → Bacteria | 3560 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10025712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3485 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10030817 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 2936 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10033640 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10033855 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10034833 | Not Available | 2600 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10039504 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2302 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10039592 | Not Available | 2298 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10066614 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10072091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1234 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10078630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1128 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10083917 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10090466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 979 | Open in IMG/M |
| 3300000234|TB_GS09_5DRAFT_10168732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 556 | Open in IMG/M |
| 3300000235|TB_PC08_3DRAFT_1015255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria → Neisseria meningitidis | 2529 | Open in IMG/M |
| 3300000235|TB_PC08_3DRAFT_1097301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 510 | Open in IMG/M |
| 3300000236|TB_FS08_3DRAFT_1022901 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300000236|TB_FS08_3DRAFT_1044869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 640 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101473832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → Candidatus Oscillochloris fontis | 631 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106125991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 891 | Open in IMG/M |
| 3300001373|YBMDRAFT_10087094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1266 | Open in IMG/M |
| 3300001373|YBMDRAFT_10115710 | Not Available | 807 | Open in IMG/M |
| 3300001453|JGI20197J15136_1018413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 613 | Open in IMG/M |
| 3300001813|JGI24123J20310_1014413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1121 | Open in IMG/M |
| 3300002243|C687J29039_10353097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 504 | Open in IMG/M |
| 3300002465|LO132_10089937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1134 | Open in IMG/M |
| 3300002703|draft_11069320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3247 | Open in IMG/M |
| 3300003432|JGI20214J51088_10827439 | Not Available | 602 | Open in IMG/M |
| 3300003461|P42013CM_1009052 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
| 3300003471|FeGluNO3_10336004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1011 | Open in IMG/M |
| 3300004028|Ga0055447_10025856 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300004778|Ga0062383_10278486 | Not Available | 797 | Open in IMG/M |
| 3300005077|Ga0071116_1046157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2784 | Open in IMG/M |
| 3300005077|Ga0071116_1140869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1124 | Open in IMG/M |
| 3300005077|Ga0071116_1150489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1056 | Open in IMG/M |
| 3300005331|Ga0070670_100137145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 | 2115 | Open in IMG/M |
| 3300005529|Ga0070741_10050696 | All Organisms → cellular organisms → Bacteria | 5045 | Open in IMG/M |
| 3300005573|Ga0078972_1113088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1475 | Open in IMG/M |
| 3300005829|Ga0074479_10433200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1056 | Open in IMG/M |
| 3300005831|Ga0074471_10014828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1518 | Open in IMG/M |
| 3300005833|Ga0074472_10014416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
| 3300005833|Ga0074472_10666382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. RU47 | 510 | Open in IMG/M |
| 3300005833|Ga0074472_11453380 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
| 3300005836|Ga0074470_10851436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 636 | Open in IMG/M |
| 3300005836|Ga0074470_11321382 | All Organisms → cellular organisms → Bacteria | 3548 | Open in IMG/M |
| 3300005836|Ga0074470_11361731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 826 | Open in IMG/M |
| 3300005836|Ga0074470_11473575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2874 | Open in IMG/M |
| 3300005836|Ga0074470_11582376 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005839|Ga0068707_1059870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 1640 | Open in IMG/M |
| 3300005916|Ga0075120_10052450 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300005989|Ga0075154_10634420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 578 | Open in IMG/M |
| 3300006033|Ga0075012_10551037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 733 | Open in IMG/M |
| 3300006056|Ga0075163_11116415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 797 | Open in IMG/M |
| 3300006092|Ga0082021_1140715 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300006381|Ga0079102_1348489 | Not Available | 905 | Open in IMG/M |
| 3300006389|Ga0079064_1373571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 656 | Open in IMG/M |
| 3300006845|Ga0075421_101482422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 743 | Open in IMG/M |
| 3300006847|Ga0075431_100327198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1544 | Open in IMG/M |
| 3300006865|Ga0073934_10188406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1418 | Open in IMG/M |
| 3300007072|Ga0073932_1015523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5708 | Open in IMG/M |
| 3300007072|Ga0073932_1192603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 808 | Open in IMG/M |
| 3300007351|Ga0104751_1011501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7855 | Open in IMG/M |
| 3300008005|Ga0100385_1102498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1620 | Open in IMG/M |
| 3300008011|Ga0100396_1047076 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300009032|Ga0105048_10346108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_3_um_filter_57_17 | 1614 | Open in IMG/M |
| 3300009032|Ga0105048_10636468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1016 | Open in IMG/M |
| 3300009032|Ga0105048_10864714 | Not Available | 799 | Open in IMG/M |
| 3300009032|Ga0105048_10872257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 794 | Open in IMG/M |
| 3300009032|Ga0105048_11044762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 690 | Open in IMG/M |
| 3300009032|Ga0105048_11283832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 590 | Open in IMG/M |
| 3300009039|Ga0105152_10045823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1743 | Open in IMG/M |
| 3300009056|Ga0102860_1160343 | Not Available | 638 | Open in IMG/M |
| 3300009081|Ga0105098_10389492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 689 | Open in IMG/M |
| 3300009082|Ga0105099_10074744 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300009083|Ga0105047_10190742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2337 | Open in IMG/M |
| 3300009083|Ga0105047_10195883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2293 | Open in IMG/M |
| 3300009083|Ga0105047_10207981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2197 | Open in IMG/M |
| 3300009083|Ga0105047_10421952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1307 | Open in IMG/M |
| 3300009083|Ga0105047_10439069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1269 | Open in IMG/M |
| 3300009083|Ga0105047_10475113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1196 | Open in IMG/M |
| 3300009083|Ga0105047_10646158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 945 | Open in IMG/M |
| 3300009084|Ga0105046_10167471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2604 | Open in IMG/M |
| 3300009084|Ga0105046_10337475 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300009084|Ga0105046_11109462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300009085|Ga0105103_10646708 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009091|Ga0102851_13416502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 510 | Open in IMG/M |
| 3300009091|Ga0102851_13418260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 510 | Open in IMG/M |
| 3300009100|Ga0075418_10399850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 1469 | Open in IMG/M |
| 3300009111|Ga0115026_11130622 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon | 634 | Open in IMG/M |
| 3300009146|Ga0105091_10122417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1206 | Open in IMG/M |
| 3300009146|Ga0105091_10503735 | Not Available | 615 | Open in IMG/M |
| 3300009146|Ga0105091_10573775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 580 | Open in IMG/M |
| 3300009146|Ga0105091_10672607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 540 | Open in IMG/M |
| 3300009153|Ga0105094_10074925 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300009165|Ga0105102_10567248 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009167|Ga0113563_10360186 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300009179|Ga0115028_11400035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 588 | Open in IMG/M |
| 3300009311|Ga0117906_1047107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1829 | Open in IMG/M |
| 3300009378|Ga0118726_1153496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 880 | Open in IMG/M |
| 3300009488|Ga0114925_10504445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 848 | Open in IMG/M |
| 3300009504|Ga0114946_10017831 | All Organisms → cellular organisms → Bacteria | 4291 | Open in IMG/M |
| 3300009540|Ga0073899_10133792 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300009566|Ga0130025_1130912 | All Organisms → cellular organisms → Bacteria | 5379 | Open in IMG/M |
| 3300009673|Ga0116185_1266722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 748 | Open in IMG/M |
| 3300009690|Ga0116143_10024469 | All Organisms → cellular organisms → Bacteria | 4146 | Open in IMG/M |
| 3300009690|Ga0116143_10082908 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300009770|Ga0123332_1029050 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
| 3300009868|Ga0130016_10027251 | All Organisms → cellular organisms → Bacteria | 7246 | Open in IMG/M |
| 3300009868|Ga0130016_10044712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4827 | Open in IMG/M |
| 3300009868|Ga0130016_10072494 | All Organisms → cellular organisms → Bacteria | 3271 | Open in IMG/M |
| 3300009868|Ga0130016_10077480 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → unclassified Candidatus Thermoplasmatota → Candidatus Thermoplasmatota archaeon | 3102 | Open in IMG/M |
| 3300009868|Ga0130016_10119204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2225 | Open in IMG/M |
| 3300009868|Ga0130016_10189692 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300009868|Ga0130016_10272643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1206 | Open in IMG/M |
| 3300009868|Ga0130016_10302772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1117 | Open in IMG/M |
| 3300009868|Ga0130016_10352619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1000 | Open in IMG/M |
| 3300009868|Ga0130016_10915131 | Not Available | 510 | Open in IMG/M |
| 3300010293|Ga0116204_1257708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 44-23 | 551 | Open in IMG/M |
| 3300010302|Ga0116202_10190824 | Not Available | 956 | Open in IMG/M |
| 3300010319|Ga0136653_10132115 | Not Available | 1182 | Open in IMG/M |
| 3300010342|Ga0116252_10142523 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin179 | 1572 | Open in IMG/M |
| 3300010348|Ga0116255_10822891 | Not Available | 581 | Open in IMG/M |
| 3300010356|Ga0116237_10184671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Tepidiformia → unclassified Tepidiformia → Chloroflexi bacterium OLB14 | 1987 | Open in IMG/M |
| 3300010357|Ga0116249_10083984 | Not Available | 3036 | Open in IMG/M |
| 3300010391|Ga0136847_11585077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 680 | Open in IMG/M |
| 3300010965|Ga0138308_111067 | All Organisms → cellular organisms → Bacteria | 5421 | Open in IMG/M |
| 3300010965|Ga0138308_171606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NEAU-383 | 1286 | Open in IMG/M |
| 3300010965|Ga0138308_184744 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300010965|Ga0138308_192890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1050 | Open in IMG/M |
| 3300011007|Ga0139299_1152821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 806 | Open in IMG/M |
| 3300011437|Ga0137429_1253751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 545 | Open in IMG/M |
| 3300012113|Ga0137328_1004764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 1035 | Open in IMG/M |
| 3300012152|Ga0137347_1041519 | Not Available | 754 | Open in IMG/M |
| 3300012160|Ga0137349_1016731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 1129 | Open in IMG/M |
| 3300012168|Ga0137357_1008565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1931 | Open in IMG/M |
| 3300012228|Ga0137459_1085714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 909 | Open in IMG/M |
| 3300012533|Ga0138256_10703832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ardenticatenia → Ardenticatenales → Ardenticatenaceae → Candidatus Promineofilum → Candidatus Promineofilum breve | 788 | Open in IMG/M |
| 3300012533|Ga0138256_11184869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 568 | Open in IMG/M |
| 3300012533|Ga0138256_11381125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 517 | Open in IMG/M |
| 3300012668|Ga0157216_10187862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 983 | Open in IMG/M |
| 3300012675|Ga0137337_1006213 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300012676|Ga0137341_1059856 | All Organisms → cellular organisms → Bacteria → PVC group → Kiritimatiellota → Kiritimatiellia → Kiritimatiellales → Pontiellaceae → Pontiella → Pontiella desulfatans | 639 | Open in IMG/M |
| 3300012931|Ga0153915_10747104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1132 | Open in IMG/M |
| 3300012931|Ga0153915_12640384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin360 | 587 | Open in IMG/M |
| 3300012956|Ga0154020_10725420 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300013090|Ga0163209_1239874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 621 | Open in IMG/M |
| 3300013092|Ga0163199_1112719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1133 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10006187 | All Organisms → cellular organisms → Bacteria | 13001 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10013479 | All Organisms → cellular organisms → Bacteria | 7496 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10031173 | All Organisms → cellular organisms → Bacteria | 3994 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10038748 | All Organisms → cellular organisms → Bacteria | 3393 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10046780 | All Organisms → cellular organisms → Bacteria | 2944 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10047166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2925 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10048378 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10058064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2515 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10060599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2437 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10066232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 2285 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10109019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1591 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10109818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1582 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10112100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1559 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10129960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1401 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10149499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1266 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10203480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1012 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10262752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 839 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10268298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 826 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10330452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 710 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10445391 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10459323 | Not Available | 562 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10063060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2668 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10073832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2375 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10080728 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10133678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1537 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10135095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1525 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10135226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1524 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10162480 | Not Available | 1333 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10162525 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10179274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1240 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10224678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1052 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10236401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1014 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10244730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 988 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10254868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 959 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10284933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 884 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10296418 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia aquarii | 858 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10392936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 700 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10499315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 590 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10510664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10004343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 17724 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10030221 | All Organisms → cellular organisms → Bacteria | 4755 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10052861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus exercitus | 3210 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10052861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus exercitus | 3210 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10104269 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Theionarchaea | 1986 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10125002 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10125890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1742 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10125890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1742 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10128895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1714 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10148786 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10188349 | Not Available | 1313 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10202309 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | 1249 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10288180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 976 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10303048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 943 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10334148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 880 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10336323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 876 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10337144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 875 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10493359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Sphaerospermopsis → unclassified Sphaerospermopsis → Sphaerospermopsis sp. SIO1G2 | 674 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10525187 | Not Available | 646 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10558844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10562678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 617 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10686198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 541 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10024302 | All Organisms → cellular organisms → Bacteria | 6144 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10052122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3513 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10135721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1776 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10142467 | Not Available | 1717 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10145561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1692 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10257613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium aquaticum | 1147 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10570212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 680 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10034475 | All Organisms → cellular organisms → Bacteria | 5295 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10206697 | Not Available | 1481 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10404905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 931 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10608901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 704 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10750317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 611 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10456777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 882 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10772984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10105960 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10107616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1953 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10121036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1796 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10126773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1736 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10128925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1716 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10167480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1421 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10176275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1370 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10190125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1297 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10212567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1195 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10213453 | Not Available | 1191 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10222174 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10222382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1156 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10244321 | Not Available | 1079 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10299665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 930 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10338346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Pontibacter → unclassified Pontibacter → Pontibacter sp. 172403-2 | 852 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10375534 | Not Available | 790 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10378824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 785 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10475418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 668 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10151742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 | 1883 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10662596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10973282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 506 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10073012 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10074416 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10168544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1902 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10264119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 1390 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10270420 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10387377 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10543744 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10585633 | Not Available | 783 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10634440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10654440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 722 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10698359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 689 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10785572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 632 | Open in IMG/M |
| 3300013760|Ga0120188_1011353 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300014023|Ga0119891_105580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 813 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10181218 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10368756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 834 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10440305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 741 | Open in IMG/M |
| 3300014839|Ga0182027_10035478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6424 | Open in IMG/M |
| 3300014883|Ga0180086_1083873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 798 | Open in IMG/M |
| 3300015257|Ga0180067_1027720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1121 | Open in IMG/M |
| 3300015257|Ga0180067_1113073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 617 | Open in IMG/M |
| 3300018052|Ga0184638_1077046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 1222 | Open in IMG/M |
| 3300018055|Ga0184616_10404857 | Not Available | 511 | Open in IMG/M |
| 3300018059|Ga0184615_10005605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6756 | Open in IMG/M |
| 3300018059|Ga0184615_10042550 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
| 3300018059|Ga0184615_10092313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1701 | Open in IMG/M |
| 3300018059|Ga0184615_10131157 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1414 | Open in IMG/M |
| 3300018059|Ga0184615_10252017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 989 | Open in IMG/M |
| 3300018059|Ga0184615_10477908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300018082|Ga0184639_10388312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 722 | Open in IMG/M |
| 3300020003|Ga0193739_1069130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 901 | Open in IMG/M |
| 3300020074|Ga0194113_10592208 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300020074|Ga0194113_10918456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 590 | Open in IMG/M |
| 3300020083|Ga0194111_10082368 | All Organisms → cellular organisms → Bacteria | 2651 | Open in IMG/M |
| 3300020083|Ga0194111_10597780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 692 | Open in IMG/M |
| 3300020198|Ga0194120_10175408 | Not Available | 1228 | Open in IMG/M |
| 3300020198|Ga0194120_10177611 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1216 | Open in IMG/M |
| 3300020220|Ga0194119_10539561 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300020220|Ga0194119_10605526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Abditibacteriota → unclassified Abditibacteriota → Abditibacteriota bacterium | 674 | Open in IMG/M |
| 3300020221|Ga0194127_10228389 | Not Available | 1290 | Open in IMG/M |
| 3300020221|Ga0194127_10343965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 997 | Open in IMG/M |
| 3300020578|Ga0194129_10053739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3038 | Open in IMG/M |
| 3300020603|Ga0194126_10253592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1209 | Open in IMG/M |
| 3300020603|Ga0194126_10359244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 945 | Open in IMG/M |
| 3300021090|Ga0210377_10033345 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
| 3300021090|Ga0210377_10082854 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300021090|Ga0210377_10287188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1012 | Open in IMG/M |
| 3300021090|Ga0210377_10495894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 706 | Open in IMG/M |
| 3300021604|Ga0226835_1011610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1926 | Open in IMG/M |
| 3300021604|Ga0226835_1013831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1657 | Open in IMG/M |
| 3300021604|Ga0226835_1019855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1198 | Open in IMG/M |
| 3300021970|Ga0232057_1361257 | Not Available | 847 | Open in IMG/M |
| 3300022151|Ga0232064_114437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium estertheticum | 871 | Open in IMG/M |
| 3300022205|Ga0224511_10349136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1098 | Open in IMG/M |
| 3300022208|Ga0224495_10046921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1973 | Open in IMG/M |
| 3300022208|Ga0224495_10180937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 888 | Open in IMG/M |
| 3300022554|Ga0212093_1079716 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300022556|Ga0212121_10125090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1914 | Open in IMG/M |
| 3300022556|Ga0212121_10349802 | Not Available | 982 | Open in IMG/M |
| 3300022556|Ga0212121_10666807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 644 | Open in IMG/M |
| 3300023201|Ga0256614_1083915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 545 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10179124 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300023211|Ga0255842_1283409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1636 | Open in IMG/M |
| 3300023258|Ga0224535_1063666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 829 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10179636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1062 | Open in IMG/M |
| (restricted) 3300024300|Ga0233420_10019680 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| (restricted) 3300024341|Ga0233421_10005490 | All Organisms → cellular organisms → Bacteria | 4212 | Open in IMG/M |
| 3300025107|Ga0208863_1074079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii | 926 | Open in IMG/M |
| 3300025135|Ga0209498_1231494 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 655 | Open in IMG/M |
| 3300025164|Ga0209521_10104291 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300025164|Ga0209521_10213426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1149 | Open in IMG/M |
| 3300025174|Ga0209324_10484324 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300025279|Ga0208047_1093348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 762 | Open in IMG/M |
| 3300025289|Ga0209002_10125526 | Not Available | 1661 | Open in IMG/M |
| 3300025310|Ga0209172_10230847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 956 | Open in IMG/M |
| 3300025313|Ga0209431_10306670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1241 | Open in IMG/M |
| 3300025313|Ga0209431_10838277 | Not Available | 665 | Open in IMG/M |
| 3300025318|Ga0209519_10579700 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025325|Ga0209341_10078683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2787 | Open in IMG/M |
| 3300025327|Ga0209751_11043474 | Not Available | 614 | Open in IMG/M |
| 3300025678|Ga0208695_1097857 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin179 | 934 | Open in IMG/M |
| 3300025708|Ga0209201_1035848 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300025807|Ga0208828_1035660 | Not Available | 1202 | Open in IMG/M |
| 3300025837|Ga0210016_1045350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2407 | Open in IMG/M |
| 3300025843|Ga0209182_10002424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 5585 | Open in IMG/M |
| 3300025844|Ga0210036_1013712 | All Organisms → cellular organisms → Bacteria | 5142 | Open in IMG/M |
| 3300025859|Ga0209096_1170382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 841 | Open in IMG/M |
| 3300025888|Ga0209540_10037069 | All Organisms → cellular organisms → Bacteria | 3011 | Open in IMG/M |
| 3300026278|Ga0209018_1035424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 1237 | Open in IMG/M |
| 3300027675|Ga0209077_1014432 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300027726|Ga0209285_10108250 | Not Available | 850 | Open in IMG/M |
| 3300027731|Ga0209592_1089593 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300027739|Ga0209575_10067924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1303 | Open in IMG/M |
| 3300027762|Ga0209288_10190498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-6 | 668 | Open in IMG/M |
| 3300027851|Ga0209066_10348097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 810 | Open in IMG/M |
| 3300027880|Ga0209481_10480088 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027885|Ga0209450_10406566 | Not Available | 993 | Open in IMG/M |
| 3300027885|Ga0209450_11178631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 533 | Open in IMG/M |
| 3300027887|Ga0208980_10069900 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300027897|Ga0209254_10269932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1318 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10142295 | Not Available | 1031 | Open in IMG/M |
| 3300028283|Ga0268283_1213487 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300028647|Ga0272412_1011775 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
| 3300028647|Ga0272412_1047212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1827 | Open in IMG/M |
| 3300028647|Ga0272412_1211216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 800 | Open in IMG/M |
| 3300028735|Ga0272446_1001010 | All Organisms → cellular organisms → Bacteria | 42324 | Open in IMG/M |
| (restricted) 3300028737|Ga0233419_10052056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 953 | Open in IMG/M |
| 3300028804|Ga0268298_10016065 | All Organisms → cellular organisms → Bacteria | 5890 | Open in IMG/M |
| 3300028804|Ga0268298_10016065 | All Organisms → cellular organisms → Bacteria | 5890 | Open in IMG/M |
| 3300028804|Ga0268298_10026274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 4220 | Open in IMG/M |
| 3300028804|Ga0268298_10040080 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
| 3300028804|Ga0268298_10065958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Achromatium → environmental samples → uncultured Achromatium sp. | 2283 | Open in IMG/M |
| 3300028804|Ga0268298_10094336 | Not Available | 1799 | Open in IMG/M |
| 3300028804|Ga0268298_10100814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1720 | Open in IMG/M |
| 3300028804|Ga0268298_10101133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1717 | Open in IMG/M |
| 3300028804|Ga0268298_10125731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1485 | Open in IMG/M |
| 3300028804|Ga0268298_10162709 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300028804|Ga0268298_10193589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1113 | Open in IMG/M |
| 3300028804|Ga0268298_10274011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 884 | Open in IMG/M |
| 3300028804|Ga0268298_10557991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 550 | Open in IMG/M |
| 3300028804|Ga0268298_10599541 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028804|Ga0268298_10630261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 506 | Open in IMG/M |
| 3300028804|Ga0268298_10632399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 505 | Open in IMG/M |
| 3300029304|Ga0119857_1053190 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300029998|Ga0302271_10300327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 701 | Open in IMG/M |
| 3300030000|Ga0311337_10651857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 908 | Open in IMG/M |
| 3300030000|Ga0311337_10696382 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300030000|Ga0311337_11740804 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300030002|Ga0311350_10514839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1075 | Open in IMG/M |
| 3300030019|Ga0311348_10227913 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300030114|Ga0311333_10416143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1090 | Open in IMG/M |
| 3300030613|Ga0299915_10004923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 9767 | Open in IMG/M |
| 3300030613|Ga0299915_10302372 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300030943|Ga0311366_11953328 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031232|Ga0302323_101330779 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300031232|Ga0302323_102584355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 580 | Open in IMG/M |
| 3300031576|Ga0247727_10273931 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300031576|Ga0247727_10384044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1142 | Open in IMG/M |
| 3300031576|Ga0247727_10587694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 840 | Open in IMG/M |
| 3300031576|Ga0247727_10644696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 786 | Open in IMG/M |
| 3300031576|Ga0247727_10733636 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031576|Ga0247727_10740732 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031576|Ga0247727_10865470 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031722|Ga0311351_10791869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 723 | Open in IMG/M |
| 3300031726|Ga0302321_101119743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG2_30_64_16 | 900 | Open in IMG/M |
| 3300031726|Ga0302321_101999592 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031873|Ga0315297_10036774 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
| 3300031873|Ga0315297_10079961 | Not Available | 2553 | Open in IMG/M |
| 3300031873|Ga0315297_10172046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1771 | Open in IMG/M |
| 3300031949|Ga0214473_10865519 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031965|Ga0326597_10705590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 1061 | Open in IMG/M |
| 3300031997|Ga0315278_11479705 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032018|Ga0315272_10202121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 947 | Open in IMG/M |
| 3300032018|Ga0315272_10663764 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032046|Ga0315289_10522635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1132 | Open in IMG/M |
| 3300032069|Ga0315282_10004811 | All Organisms → cellular organisms → Bacteria | 23345 | Open in IMG/M |
| 3300032163|Ga0315281_10044325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5487 | Open in IMG/M |
| 3300032163|Ga0315281_10322571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1681 | Open in IMG/M |
| 3300032173|Ga0315268_10118584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2498 | Open in IMG/M |
| 3300032256|Ga0315271_11512483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 578 | Open in IMG/M |
| 3300032397|Ga0315287_10051284 | All Organisms → cellular organisms → Bacteria | 4541 | Open in IMG/M |
| 3300032401|Ga0315275_11479447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 730 | Open in IMG/M |
| 3300032420|Ga0335397_10060092 | All Organisms → cellular organisms → Bacteria | 4109 | Open in IMG/M |
| 3300032420|Ga0335397_10128529 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300032420|Ga0335397_10163961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 2169 | Open in IMG/M |
| 3300032420|Ga0335397_10188194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1976 | Open in IMG/M |
| 3300032420|Ga0335397_10270120 | Not Available | 1538 | Open in IMG/M |
| 3300032420|Ga0335397_10367810 | Not Available | 1230 | Open in IMG/M |
| 3300032420|Ga0335397_10412543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1129 | Open in IMG/M |
| 3300032420|Ga0335397_10427777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-2 | 1099 | Open in IMG/M |
| 3300032456|Ga0335394_10828089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 660 | Open in IMG/M |
| 3300033233|Ga0334722_10164799 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300033415|Ga0316607_1028657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1221 | Open in IMG/M |
| 3300033418|Ga0316625_100302708 | Not Available | 1140 | Open in IMG/M |
| 3300033418|Ga0316625_101648002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 615 | Open in IMG/M |
| 3300033418|Ga0316625_102166400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Azambacteria → Candidatus Azambacteria bacterium RIFCSPLOWO2_02_FULL_44_14 | 552 | Open in IMG/M |
| 3300033420|Ga0316608_1104520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 766 | Open in IMG/M |
| 3300033420|Ga0316608_1133445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 652 | Open in IMG/M |
| 3300033429|Ga0316193_10264590 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300033433|Ga0326726_11956316 | Not Available | 571 | Open in IMG/M |
| 3300033446|Ga0316611_1008386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electronema → unclassified Candidatus Electronema → Candidatus Electronema sp. GS | 3266 | Open in IMG/M |
| 3300033446|Ga0316611_1057536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1042 | Open in IMG/M |
| 3300033446|Ga0316611_1059832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1015 | Open in IMG/M |
| 3300033480|Ga0316620_10596628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1036 | Open in IMG/M |
| 3300033480|Ga0316620_12224646 | Not Available | 545 | Open in IMG/M |
| 3300033482|Ga0316627_100079564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 | 2152 | Open in IMG/M |
| 3300033482|Ga0316627_101420114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 698 | Open in IMG/M |
| 3300033482|Ga0316627_102982124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 504 | Open in IMG/M |
| 3300033498|Ga0316610_1063330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 862 | Open in IMG/M |
| 3300033498|Ga0316610_1104596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 629 | Open in IMG/M |
| 3300033521|Ga0316616_101329121 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300033521|Ga0316616_101848115 | Not Available | 795 | Open in IMG/M |
| 3300033521|Ga0316616_103337668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 605 | Open in IMG/M |
| 3300033557|Ga0316617_102587860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 527 | Open in IMG/M |
| 3300033557|Ga0316617_102697960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 517 | Open in IMG/M |
| 3300034090|Ga0326723_0213727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 856 | Open in IMG/M |
| 3300034177|Ga0364932_0165156 | Not Available | 842 | Open in IMG/M |
| 3300034627|Ga0316609_037865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 874 | Open in IMG/M |
| 3300034627|Ga0316609_093137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 550 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.46% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 10.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 5.25% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.80% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 3.80% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.36% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.17% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.17% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.17% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat | 1.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.99% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.81% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.27% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.27% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.27% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.91% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
| Anaerobic Bioreactor Biomass | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass | 0.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.54% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.54% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.54% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.54% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.36% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.36% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.36% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.36% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.36% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.36% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.36% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.36% |
| Hydrothermal Vent Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.36% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.36% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.36% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.18% |
| Basal Ice | Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice | 0.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.18% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.18% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.18% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.18% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.18% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.18% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.18% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.18% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 0.18% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 0.18% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 0.18% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.18% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.18% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.18% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.18% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.18% |
| Wetland Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment | 0.18% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.18% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.18% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.18% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.18% |
| Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 0.18% |
| Aquifer Solids | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids | 0.18% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.18% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.18% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.18% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.18% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.18% |
| Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.18% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.18% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.18% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.18% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.18% |
| Anaerobic Bioreactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor | 0.18% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 3300000227 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- AS07_7 | Environmental | Open in IMG/M |
| 3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
| 3300000230 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 | Environmental | Open in IMG/M |
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300000232 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_64 | Environmental | Open in IMG/M |
| 3300000233 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10 | Environmental | Open in IMG/M |
| 3300000234 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS09_5 | Environmental | Open in IMG/M |
| 3300000235 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_3 | Environmental | Open in IMG/M |
| 3300000236 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS08_3 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001373 | YB-Mouth-sed | Environmental | Open in IMG/M |
| 3300001453 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 | Environmental | Open in IMG/M |
| 3300001813 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A | Environmental | Open in IMG/M |
| 3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
| 3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
| 3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003461 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P4 sample | Environmental | Open in IMG/M |
| 3300003471 | Fe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions. | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005839 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP MetaG | Environmental | Open in IMG/M |
| 3300005916 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKL | Environmental | Open in IMG/M |
| 3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
| 3300006381 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006389 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
| 3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
| 3300008002 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14 | Environmental | Open in IMG/M |
| 3300008004 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-19 | Environmental | Open in IMG/M |
| 3300008005 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-09 | Environmental | Open in IMG/M |
| 3300008011 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009311 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009378 | Combined Assembly of Gp0137076, Gp0137077 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300009566 | Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB | Environmental | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009770 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010302 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 325m metaG | Environmental | Open in IMG/M |
| 3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010348 | AD_HKYLca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300011007 | Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012113 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
| 3300013090 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m | Environmental | Open in IMG/M |
| 3300013091 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014023 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_AS_meta | Engineered | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021494 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-2-3_MG | Environmental | Open in IMG/M |
| 3300021505 | Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-0-1_MG | Environmental | Open in IMG/M |
| 3300021604 | Anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaG_1 | Engineered | Open in IMG/M |
| 3300021970 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300022151 | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_8 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300022205 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
| 3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
| 3300023201 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN | Engineered | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300023211 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA | Engineered | Open in IMG/M |
| 3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300024300 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_102_MG | Environmental | Open in IMG/M |
| 3300024341 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_107_MG | Environmental | Open in IMG/M |
| 3300025014 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025031 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 (SPAdes) | Environmental | Open in IMG/M |
| 3300025107 | Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025279 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes) | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025678 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025807 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes) | Environmental | Open in IMG/M |
| 3300025837 | Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025844 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15 (SPAdes) | Environmental | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026278 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant BLVA 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
| 3300028645 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028734 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028735 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-006-1 | Environmental | Open in IMG/M |
| 3300028737 (restricted) | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_100_MG | Environmental | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300029304 | Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina | Engineered | Open in IMG/M |
| 3300029890 | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2157 | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033415 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.062E | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033420 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.152B | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033446 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.202 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033498 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111B | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034627 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.108B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_GZOS_CLC_00094620 | 2124908035 | Soil | VDSAWEQKKLEARKMLENAAESPASSARFVGQFFLVK |
| P3_CLC_00522010 | 2124908041 | Soil | VDNAWEQKKLEARKMLENAAESPASSARFVRRFCCARLTG |
| TB_AS07_7DRAFT_100322511 | 3300000227 | Groundwater | VDSVWEQEKLEARKMLENAAESHTSGARFVSPLCFFA* |
| TB_AS07_7DRAFT_100403143 | 3300000227 | Groundwater | CVWAGVDSAWEQEKLEARKMLENAADSHTSGARFVRLRSNFN* |
| TB_AS07_7DRAFT_100464573 | 3300000227 | Groundwater | EDNAWEQKKLEARKMPVSRDESHQSGARFVRCGID* |
| TB_AS07_7DRAFT_100913992 | 3300000227 | Groundwater | VWAGVDSAWEQEKPEARKMLENAADSHTSGGRVRG* |
| TB_PC08_66DRAFT_100023261 | 3300000228 | Groundwater | MWVGVDNAWEQEKPEARKMLVNRADSHTSGACFVR |
| TB_PC08_66DRAFT_100176443 | 3300000228 | Groundwater | WAGVDNAWEQEKLEARKMLVNRAESHTSGARFVRPRP* |
| TB_PC08_66DRAFT_100193191 | 3300000228 | Groundwater | AGVDNAWEQEKLEARKMLENAAESHTSGARFVSPLLFNREDIFA* |
| TB_PC08_66DRAFT_100690522 | 3300000228 | Groundwater | DNAWEQEKLEARKMPENAAESHTSGARFVVPLLD* |
| TB_PC08_66DRAFT_100729273 | 3300000228 | Groundwater | VWAGVDNAWEQEKPEARKMLVNRADSHTSGARFVGQ |
| TB_PC08_66DRAFT_100741362 | 3300000228 | Groundwater | GVDNAWEQEKLEARKMLENAAESHTSGARFVRRHL* |
| TB_PC08_66DRAFT_100876033 | 3300000228 | Groundwater | WAGVDSVWEQKKLEARKMLVNRAESHTSGARFVGRF* |
| TB_PC08_66DRAFT_100970341 | 3300000228 | Groundwater | NAWEQEKPEARKMLENAAESHTSGARFVSHRFVVQDSFAF* |
| TB_PC08_66DRAFT_100972652 | 3300000228 | Groundwater | VXNAWEQEKPEARKMLVNXAESHTSGARFVGWLCARLAD* |
| TB_PC08_66DRAFT_101053681 | 3300000228 | Groundwater | NAWEQEKPEARKMLENAAESHTSGARFVGWLCARCAD* |
| TB_PC08_66DRAFT_101183683 | 3300000228 | Groundwater | WAGVDNAWEQEKLEARKMLENAAESHTSGARFVGRLCARRAN* |
| TB_PC08_66DRAFT_101265102 | 3300000228 | Groundwater | NAWEQENAEARKMLENAAESHTSGARFVRPRLCF* |
| TB_PC08_66DRAFT_101301191 | 3300000228 | Groundwater | VTRVWVGVDSIWEQEKPEARKILENRADSHTSGARFVGRAYA* |
| TB_PC08_66DRAFT_101317043 | 3300000228 | Groundwater | DNAWEQEKLEARKMLVNRADSHTSGARFVSLLLTLRLLAF* |
| TB_PC08_66DRAFT_101714451 | 3300000228 | Groundwater | WEQEKLEARKMLENAAESHTSGARFVGRFLLCKTR* |
| TB_PC08_66DRAFT_101868002 | 3300000228 | Groundwater | MLWEQEKLEARKMLENAAESHTSGARFVSPLFAFKTHPN* |
| TB_PC08_66DRAFT_101896813 | 3300000228 | Groundwater | VWAGVDKAWEQEKLEARKMLVNRAESHTSGARFVSPLLALKGNAL* |
| TB_GS10_10DRAFT_100302512 | 3300000230 | Groundwater | VWAGVDSAWEQEKLEAWKMLENAAESHTSGARFVGTLLTLRLTC* |
| TB_GS10_10DRAFT_100355691 | 3300000230 | Groundwater | GVDNAWEQEKLEARKMLVNRADSHTSGARFVSLLLTLRLLAF* |
| TB_GS10_10DRAFT_100389621 | 3300000230 | Groundwater | AGVDNAWEQEKPEARKMLVNRADSHTSGARFVRRS* |
| TB_GS10_10DRAFT_100580241 | 3300000230 | Groundwater | WAGVDNAWEQRKLEARKMLVNRAESHTSGARFVRPRHCF* |
| TB_GS10_10DRAFT_100933601 | 3300000230 | Groundwater | NAWEQEKLEARKMLLKRADSHTSGARFVSLFLTLETT* |
| TB_GS10_10DRAFT_101514791 | 3300000230 | Groundwater | WAGVDNAWEQENAEARKMPVNRADSHTSGARFVRCG* |
| TB_GS10_10DRAFT_101627072 | 3300000230 | Groundwater | AGVDNAWEQEKPEARKMLLNRADSHTSGARFVSPLPF* |
| TB_GS10_10DRAFT_101662343 | 3300000230 | Groundwater | GVDNTWEQKNAEARKMLENAAESHTSGARFVRPVFVF* |
| TB_GS10_10DRAFT_101673772 | 3300000230 | Groundwater | CVTCVWAGVDSVWEQEKLEARKMLENAAESHTSGARFVSPFFA* |
| TB_GS10_10DRAFT_101864532 | 3300000230 | Groundwater | WAGVDNAWEQEKPEARKMLVNRAESHTSGARFVRHGRT* |
| TB_GS10_10DRAFT_102266752 | 3300000230 | Groundwater | AWEQEKLEARKMLLNRAESHTSGARFVGQFLFANV* |
| TB_GS10_10DRAFT_102460042 | 3300000230 | Groundwater | AGVDNVWEQEKLEARKMLINRADSHTSGARFVRWRFRDCDFML* |
| TB_LI09_4DRAFT_100620061 | 3300000231 | Groundwater | GVDNAWEQKKLEARKMLLNRADSHTSGARFVRRLLLKYPIFIKH* |
| TB_LI09_4DRAFT_100750411 | 3300000231 | Groundwater | VWAGVDNVWEQEKLEARKMLENAAESHTSGARFVSPLS |
| TB_LI09_4DRAFT_101330001 | 3300000231 | Groundwater | CVWAGVDNAWEQEKLEARKILENAAESHTSGARFVSPLST* |
| TB_PC08_64DRAFT_10880533 | 3300000232 | Groundwater | DNAWEQEKLDARKILENAAESHTSGARFVSQPAC* |
| TB_FS06_10DRAFT_10074599 | 3300000233 | Groundwater | VWAGVDSLWEQEKLEARKMLENAAESHTSGARFVGQPAGLPEP* |
| TB_FS06_10DRAFT_10438271 | 3300000233 | Groundwater | VWAGVDNAWEQEKPEARKMPVNRAESHTSGARFVGWLCARRAD* |
| TB_FS06_10DRAFT_10455921 | 3300000233 | Groundwater | CVWAGVDNAWEQEKLEARKMLLKRAESHTSGARFVGQPLR* |
| TB_FS06_10DRAFT_10501172 | 3300000233 | Groundwater | VWAGVDSAWEQKKLKARKMLVNRADSHTSGARFVGQFLFISYLFS |
| TB_GS09_5DRAFT_100251451 | 3300000234 | Groundwater | WAVDNAWEQEKPEARKMLLNRADSHTSGARFVGQFLT* |
| TB_GS09_5DRAFT_100257121 | 3300000234 | Groundwater | VWAGVDSAWEQEKLEARKMLENRAESHTSGARFVGRF* |
| TB_GS09_5DRAFT_100308173 | 3300000234 | Groundwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVRRRLT* |
| TB_GS09_5DRAFT_100336401 | 3300000234 | Groundwater | VWAGVDSAWEQEKLEARKMLENAAREASHTSGARFVRPAFDF* |
| TB_GS09_5DRAFT_100338552 | 3300000234 | Groundwater | RVWAGVDSAWKQEKLEARKMLEKAAESHTSGARFVRWRF* |
| TB_GS09_5DRAFT_100348336 | 3300000234 | Groundwater | VWAGVDSAWEQEKPEARKMLVNRAESHTSGARFVGWLCARLAD* |
| TB_GS09_5DRAFT_100395041 | 3300000234 | Groundwater | WAGVDSAWEQEKLEARKMPVNRADSHTSGARFVGTLFALRRL* |
| TB_GS09_5DRAFT_100395921 | 3300000234 | Groundwater | VWAGVDNAWEQEKLEARKMLVKCAESHTSGARFVGWRVH* |
| TB_GS09_5DRAFT_100666142 | 3300000234 | Groundwater | VWAGVDSVWEQKKLEARKMLLNRADSHLSGARFVSPLYESKGFCH* |
| TB_GS09_5DRAFT_100720913 | 3300000234 | Groundwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGRRLWNDYLP* |
| TB_GS09_5DRAFT_100786305 | 3300000234 | Groundwater | VWAGVDSLWEQEKPEARKMLENAAESHTSGARFVGWLCARLAD |
| TB_GS09_5DRAFT_100839171 | 3300000234 | Groundwater | AGVDNAWEQEKPEARKMLVNRADSHTSGARFVRRGF* |
| TB_GS09_5DRAFT_100904661 | 3300000234 | Groundwater | AGVDNAWEQKKLEARKMPVNRADSHTSGARFVRLRSWTLLLF* |
| TB_GS09_5DRAFT_101687321 | 3300000234 | Groundwater | GVDNAWEQEKLEARKMLVNRAESHTSGARFVRRGL* |
| TB_PC08_3DRAFT_10152551 | 3300000235 | Groundwater | GVDSAWEQEKLEARKMLENAAREASHTSGARFISLDF* |
| TB_PC08_3DRAFT_10232041 | 3300000235 | Groundwater | VWAGVDNAWEQEKLEAWKMLENAAESHTSGARFVGQPAYQNDG* |
| TB_PC08_3DRAFT_10973013 | 3300000235 | Groundwater | VWAGVDNAWEQEKLEARKMLENGADSHTSGARFVGRFLPTRLFCY* |
| TB_FS08_3DRAFT_10229011 | 3300000236 | Groundwater | CVWAGVDNVWEQEKLEARKILENAAESHTSGARFVGSF* |
| TB_FS08_3DRAFT_10448692 | 3300000236 | Groundwater | AGVDNAWEQEKPEARKMLVXRAESHTSGARFVSQPAR* |
| JGIcombinedJ13530_1014738322 | 3300001213 | Wetland | GVDSAWEQKKLEVRKLLINRADSQKSAARFVCWRLH* |
| JGIcombinedJ13530_1061259912 | 3300001213 | Wetland | MDSVWAQEKPEARKMVRNAAESQTSGAHFVGTLLT* |
| JGIcombinedJ13530_1076145571 | 3300001213 | Wetland | CVWAGVDSAWKQEKLEARKLFGICGQSPASSARFVGWQ* |
| YBMDRAFT_100870941 | 3300001373 | Marine Estuarine | WAGVDSVWEQYKLEARKMLKDGDESHLSSARFVGLRIQYPE* |
| YBMDRAFT_101157102 | 3300001373 | Marine Estuarine | AGVDSVWEQEKLEARKMPENAAESHTSGARFVGRFSVIQP* |
| JGI20197J15136_10184132 | 3300001453 | Arctic Peat Soil | WAGVDSAWEQDSVESWKMLENRADSLLSDARFVGRHLWFIT* |
| JGI24123J20310_10144133 | 3300001813 | Serpentinite Rock And Fluid | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVSLLFVYNVLKQ |
| JGIcombinedJ21912_101844412 | 3300002069 | Arctic Peat Soil | GVDSAWEQKKLEARKMLENGDESYLSSARFVRHGRT* |
| C687J29039_103530971 | 3300002243 | Soil | VWAGVDSVWDQKKLEARKMLENAAESHTSGARFVGWLYARLAG* |
| LO132_100899371 | 3300002465 | Freshwater Lake | MWAGVDNAWEQEKLEARKMLENAAESHTSGARFVSPLSAIRFH |
| draft_110693202 | 3300002703 | Hydrocarbon Resource Environments | VRAGVDSVWEQEKLEARKMLENAAESLTSGARFVRRFLPIV* |
| JGI20214J51088_108274391 | 3300003432 | Wetland | VWAGVDNAWVQRKLEARKMLENAAESHTSGARFVGWLIAIRLNCF |
| P42013CM_10090524 | 3300003461 | Ore Pile And Mine Drainage Contaminated Soil | VWAGVDCVWEQEKLEAREMLENAAESLTSGARFVSPLFLSLLID* |
| FeGluNO3_103360041 | 3300003471 | Wetland Sediment | RVWAAVDSAWEQEKLEARKMLENAADSHTSGARFVGWRFM* |
| JGI20214J51650_102822802 | 3300003541 | Wetland | VGVDSVGQEKHKARKMLENAAESPAAITRVVGRLHDTLV* |
| Ga0055447_100258562 | 3300004028 | Natural And Restored Wetlands | MWAGVDSIWEQEKLEARKMLAVDAAESNTSGARFVGRLFLR* |
| Ga0062383_102784862 | 3300004778 | Wetland Sediment | VDSIWEQKKTEARKILENAAESPASSARFVSPLLHFEDDFLP |
| Ga0071116_10461573 | 3300005077 | Sinkhole | VWAGVDSVWEQKKLEARKVLENAADSHTSGARFVSPLLDLEYRHGF* |
| Ga0071116_11408693 | 3300005077 | Sinkhole | VWAGVDNAWEQGKLEARKMLENAAESHTSGARFVGRRFWTN* |
| Ga0071116_11504892 | 3300005077 | Sinkhole | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGWLCARHAD* |
| Ga0070670_1001371451 | 3300005331 | Switchgrass Rhizosphere | CVTCVWAGVDSVWEQEKLEARKMLEKAAESHTSGARFVTRM* |
| Ga0070741_100506965 | 3300005529 | Surface Soil | VDSVWEQEKPEAGKMLENAAESRQSGARFVGWFYG* |
| Ga0078972_11130884 | 3300005573 | Hot Spring | VWAGVDSVWEQEKPEARKMLENAAESLQSAARFVGRLFCTPT |
| Ga0074479_100709283 | 3300005829 | Sediment (Intertidal) | VGRDSLWEQRKLEAWKMLEKAAESHLSGARFVRR* |
| Ga0074479_104332003 | 3300005829 | Sediment (Intertidal) | FDMDSAWEQKKLEARKMLENAAESHTSGARFVSPLFV* |
| Ga0074471_100148282 | 3300005831 | Sediment (Intertidal) | VWAGVDNAWEQRKLEARKMLENAAESHTSGARCVG |
| Ga0074471_111827881 | 3300005831 | Sediment (Intertidal) | VDSAWEQYKLEARKMLEKAAESPASSARFVGQLMFL |
| Ga0074472_100144162 | 3300005833 | Sediment (Intertidal) | VWADVDSVWEQEKLEARKMLGNAAESPASSARFVGQPARLPERD* |
| Ga0074472_106663821 | 3300005833 | Sediment (Intertidal) | VGVDSAWEQEKLEARKMLENAAESPASSARFVGLRF* |
| Ga0074472_114533804 | 3300005833 | Sediment (Intertidal) | VDSAWEQEKLEARKMLENAAESHTSGARFVGWLFSF* |
| Ga0074470_108514362 | 3300005836 | Sediment (Intertidal) | VDSVWEQKKLEARKMLENAAESPASSARFVGRFWVENY* |
| Ga0074470_113213823 | 3300005836 | Sediment (Intertidal) | MWAGVDSVWEQGKLEARKMSINRADSHTSGARFVGTLLTLRLDGF* |
| Ga0074470_113617312 | 3300005836 | Sediment (Intertidal) | VWAGVDSVREQEKLEARKMLENAAESHTSGARYVSRILPARDFT* |
| Ga0074470_114735754 | 3300005836 | Sediment (Intertidal) | VGVDNACGQRKLDTRKMLENAAESHTSGARFVRRFVLVTQ* |
| Ga0074470_115823762 | 3300005836 | Sediment (Intertidal) | VWAGLDSVWEQEKLEARKMLAVGAAESHTSGARFVGRSWWFKT* |
| Ga0068707_10598703 | 3300005839 | Anoxygenic And Chlorotrophic | VGVDSAGEQKKPEARKMLENGAESHHLAARFVGQFLS* |
| Ga0075120_100524503 | 3300005916 | Saline Lake | VWVGVDSVWEQEKPEARKMLENGAESHTSGARFVGRCFLP |
| Ga0075154_106344202 | 3300005989 | Wastewater Effluent | VWVGVDNAWEQGKLEAREMLENAAESHTSGARFVG |
| Ga0075012_105510371 | 3300006033 | Watersheds | VWAGVDSVWEQKKLEARKMLENAAESHTSGARFVG |
| Ga0075163_111164151 | 3300006056 | Wastewater Effluent | VWAGVDSLWEQEKPEARKMLENAADSHTSGARFVS |
| Ga0082021_11407151 | 3300006092 | Wastewater Treatment Plant | VDSVWEQEKLEARKMLVNAAESHTSGARFVSPFWDLARL* |
| Ga0079102_13484892 | 3300006381 | Anaerobic Digestor Sludge | VWAGVDSAWEQETLEARKMPENAAESHTSGARFVGQF* |
| Ga0079064_13735712 | 3300006389 | Anaerobic Digestor Sludge | VCVTCVWAGVDNAWEQEKLEAWKMLENAAESHTSGARCV |
| Ga0075421_1014824223 | 3300006845 | Populus Rhizosphere | VPTAGVTCVWAGVDSAWEQEKLEARKMLENAAESHTSGARFVG |
| Ga0075431_1003271981 | 3300006847 | Populus Rhizosphere | GVDSIWKQEKLEAKKLLAVGAAESHTSGARFVSQRRKHT* |
| Ga0073934_101884063 | 3300006865 | Hot Spring Sediment | WAGVDSAWEQEKLEARKMLENAAESHPSSARFVRWRPFIP* |
| Ga0073932_101552310 | 3300007072 | Hot Spring Sediment | VWAGEDNAWEQEKLEARKMLENAAESHTSGARFVGQRAC* |
| Ga0073932_11926033 | 3300007072 | Hot Spring Sediment | VWAGVDNAWEQEKLEARKMLENAAESHTSGARCVRCVFVF |
| Ga0104751_10115013 | 3300007351 | Deep Subsurface Aquifer | VWAGVDSVREQEKLEARKMLENAAESHTSGARFVGRRF* |
| Ga0100390_100769773 | 3300008002 | Aquifer | EQEKLEARKMLENAAESHQSAARFVGTLFVMERL* |
| Ga0100395_11770291 | 3300008004 | Aquifer | VGVDNAWEQEKPEARKMIENGDESHLSSARFVRRFLLCKTRR |
| Ga0100385_11024984 | 3300008005 | Aquifer | VWAGVDKVWEQEKLEARKMLENAAESHTSGARFVCD |
| Ga0100396_10470761 | 3300008011 | Aquifer | IGSRWWAGRDSLQEQKKLEARKMLENAAESHTSGAP* |
| Ga0105048_103461082 | 3300009032 | Freshwater | VDSAWEQEKPEARKMPENAAESPASGARFVSPLFALRIL* |
| Ga0105048_106364682 | 3300009032 | Freshwater | VGVDNAWEQEKLEARKMLENAAESHTSGARFVSPLYGFGDSY* |
| Ga0105048_108647141 | 3300009032 | Freshwater | VTRKWAGVDSAWEQKKLEARKMLEKPPTPHLSGARFVRQTR* |
| Ga0105048_108722572 | 3300009032 | Freshwater | WAGVDSVWEQEKLEAGKMLVNRADSHLSGARFVSRLFELGRLT* |
| Ga0105048_110447622 | 3300009032 | Freshwater | VWVGVDNAWEQEKPEARKMLENAAESHTSGARFVSPFLTFF |
| Ga0105048_112838321 | 3300009032 | Freshwater | VWAGVDSVWEQEKPEARKMLENRADSHLSGARFVSLLLT |
| Ga0105152_100458232 | 3300009039 | Lake Sediment | VDNAWEQEKLEARKMLENGDESHLSSARFVSPLFA* |
| Ga0102860_11603432 | 3300009056 | Estuarine | VWAGVDSAWEQKKLEARKMLENAAESHTSGARFVGWRFIQ |
| Ga0105098_100608531 | 3300009081 | Freshwater Sediment | LWAGVDSAWKQKKPEAKKMCEDATESPTAGHALLGG |
| Ga0105098_103894921 | 3300009081 | Freshwater Sediment | DNAWEQYKPQARKLLINAAHTRQSGARCVGRILPEPYF* |
| Ga0105099_100747442 | 3300009082 | Freshwater Sediment | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRFLIIIKY* |
| Ga0105047_101907422 | 3300009083 | Freshwater | VWAGVDSAWEQKKLEARKMLENAAESHTSGARFVGKPYFA* |
| Ga0105047_101958834 | 3300009083 | Freshwater | VWVGVDNAWEQEKLEARKMLENAAESHTSGARFVSPLYGFGDSY* |
| Ga0105047_102079811 | 3300009083 | Freshwater | VTRKWAGVDSARKQEKLEARKLFVKRADSHLSGARFVGRFLT* |
| Ga0105047_102921693 | 3300009083 | Freshwater | VDSAWKQKKLEARKMLENYAREASHLSDAGFVSRLFA* |
| Ga0105047_104219521 | 3300009083 | Freshwater | VDSAWEQEKPEARKMLENAAESHTSGARFVGQVLEDGF* |
| Ga0105047_104390692 | 3300009083 | Freshwater | VWAGVDNAWEQEKLEARKMPENAAESHTSGARFVSPLLVD* |
| Ga0105047_104751132 | 3300009083 | Freshwater | VDNAWEQEKLEARKMLENAAESPPSTARFVSPFCLMRAMCAKNFFILR* |
| Ga0105047_106461583 | 3300009083 | Freshwater | WAGWDNVWEQKKLEARKMLVNRADSHLSGARCVGQPCRQPKR* |
| Ga0105046_101674716 | 3300009084 | Freshwater | WAGVDSVWEQKKLEARKMLLNRADSHLSGARFVGRF* |
| Ga0105046_103374751 | 3300009084 | Freshwater | VWAGVDSVWEQEKLEARKMPENAAESHTSGARFVSPLLVD* |
| Ga0105046_111094622 | 3300009084 | Freshwater | VDNVWEQKKLEARKMLVNRADSHLSGARFVGWLFDC |
| Ga0105103_106467082 | 3300009085 | Freshwater Sediment | VWAGVDKIWEQKKLEARKMPENAAESHPSGARFVRRDLGKKN* |
| Ga0102851_134165022 | 3300009091 | Freshwater Wetlands | VDSVWEQEKPEARKMLENAAESHTSGARFVSLFFC* |
| Ga0102851_134182601 | 3300009091 | Freshwater Wetlands | VWAGVEKVWEQENAEARKMLENAADSQPSGARFVGWRLWAQDT* |
| Ga0075418_103998501 | 3300009100 | Populus Rhizosphere | VWAGVDSAWEQEKLEARKMLENAAESHTSGARCVRRFR |
| Ga0115026_111306222 | 3300009111 | Wetland | VSGVWAGVKNAREQEKPEAREMLGNAAESHMSGARFVGR* |
| Ga0105091_101224172 | 3300009146 | Freshwater Sediment | VWAGVDSVREQEKLEARKMLENAADSHTSGARFVGWHCG* |
| Ga0105091_105037351 | 3300009146 | Freshwater Sediment | MWAGGDVVWEQEKLEARIILENGDESHTSDARRTLC* |
| Ga0105091_105737752 | 3300009146 | Freshwater Sediment | VWAGVDSAWEQEKPEARKMLEKPHRTPASNARFVGRDLGKKN* |
| Ga0105091_106726071 | 3300009146 | Freshwater Sediment | VWAGLDSVWEQRKLETRKMLENAAESHTSGARFVSRR |
| Ga0105094_100749251 | 3300009153 | Freshwater Sediment | VWAGVDSVWEQEKLQARKMLENAAESHTSGARCVGRF |
| Ga0105102_105672481 | 3300009165 | Freshwater Sediment | VWAGVDSAWKQEKPEARKMLENAAESHTAGARFVSCR |
| Ga0113563_103601861 | 3300009167 | Freshwater Wetlands | VGVDSAWEQEKLEARKMLENAAESPASSARCVSPLFI |
| Ga0115028_114000352 | 3300009179 | Wetland | VWAGVDSAWEQEKLEARKMPENAAESHTSGARFVGWRLCKVPC* |
| Ga0117906_10471073 | 3300009311 | Marine | MLWEQEKLEAKKILENGAESHTSGARFVSPLLNLSNS* |
| Ga0118726_11534961 | 3300009378 | Marine | VWAGVDSAWEQEKLEARKMLENAAESHTSGARCVS |
| Ga0114925_105044452 | 3300009488 | Deep Subsurface | TGWWAGVDNAWEQKKLEARKIPVNRGESHQSGARLVRPLSYP* |
| Ga0114946_100178312 | 3300009504 | Sediment | VWAGVDSAWEQEKPDARKMLENAAESHIICARFVGRFWD* |
| Ga0073899_101337921 | 3300009540 | Activated Sludge | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGT |
| Ga0130025_11309122 | 3300009566 | Aquifer Solids | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGQLKWTLCDF* |
| Ga0116185_12667223 | 3300009673 | Anaerobic Digestor Sludge | VWAGVDSVWEQEKPEARKMLENAAESHTSGARFVRRFLPNMKLA* |
| Ga0116143_100244694 | 3300009690 | Anaerobic Digestor Sludge | VWAGVDNAWEQEKPEARKILENAAESHTSGARFVGQPACLPKP* |
| Ga0116143_100829084 | 3300009690 | Anaerobic Digestor Sludge | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVSPL |
| Ga0123332_10290501 | 3300009770 | Anaerobic Biogas Reactor | MRWWAGVDSVKEQRKLEARKMLENAADSDTSGACL |
| Ga0130016_100272515 | 3300009868 | Wastewater | VWAGVDNAWEQKKPEARKMLENAAESHTSGARFVSPLF* |
| Ga0130016_100447129 | 3300009868 | Wastewater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRLCARRAD* |
| Ga0130016_100724946 | 3300009868 | Wastewater | VWAGVDNAWEQEKLEARKMLVNRAESRQSTARFVSPLFA |
| Ga0130016_100774802 | 3300009868 | Wastewater | VWAGVDSVWEQKKLEARKMPENAAESHTSGARFVSPFLT* |
| Ga0130016_101192042 | 3300009868 | Wastewater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVRQVLEE* |
| Ga0130016_101896921 | 3300009868 | Wastewater | VWAGVDKAWEQEKPEARKMLENAAESHTSGARFVGRF* |
| Ga0130016_102726433 | 3300009868 | Wastewater | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGQFLFLRLIF* |
| Ga0130016_103027722 | 3300009868 | Wastewater | VWAGWDSAWEQGKLEARKMLENAAESHTSGARFVGTLLI* |
| Ga0130016_103526192 | 3300009868 | Wastewater | VWAGVDSIWEQEKLAARKMLENAAESHTSGARFVGQPF* |
| Ga0130016_109151311 | 3300009868 | Wastewater | VWAGVDNAWEQKKLEAWKMLENAAESHTSGARFVRRF |
| Ga0126308_101548601 | 3300010040 | Serpentine Soil | VCVTRWWVGVDSVWEPEKPEARKMLENAAESHTSGAR |
| Ga0126310_110122421 | 3300010044 | Serpentine Soil | QGYWWAGVDSAWEQYKLEVRKMLENGADSYLSSARGVGRS* |
| Ga0126310_112056262 | 3300010044 | Serpentine Soil | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGWLIALRLIETKQ* |
| Ga0133939_10652421 | 3300010051 | Industrial Wastewater | VGGVGEGWEQKKAEARKMLENGAESHQSSARFVGRRHCL* |
| Ga0116204_12577082 | 3300010293 | Anoxic Lake Water | AGVDSVWEQEKLEARKMLENAADSHTSGARCVGTLLT* |
| Ga0116202_101908241 | 3300010302 | Anoxic Lake Water | VWAGVDNAWEQKKLEARKMLENAAESHTSGARFVSPFLI* |
| Ga0136653_101321152 | 3300010319 | Anoxic Lake Water | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGRF* |
| Ga0136651_100332582 | 3300010330 | Marine Hydrothermal Vent | VDSAWEQEKLEAKKLLENAAESHLSGARFVGRSLLRKI* |
| Ga0116252_101425231 | 3300010342 | Anaerobic Digestor Sludge | VWAGVDSVREQKKLEARKMLENAAESYTSGAHFVSRL |
| Ga0116255_108228911 | 3300010348 | Anaerobic Digestor Sludge | VWAGVDSAWEQEKPEAGKMPENAAESHTSGARFVGQF* |
| Ga0116237_101846711 | 3300010356 | Anaerobic Digestor Sludge | VWAGVDNVWEQEKPEARKMLENAAESHTSGARFVGTLL |
| Ga0116249_100839841 | 3300010357 | Anaerobic Digestor Sludge | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGWRFIKVAMMAQMPFHHQI |
| Ga0136847_105595212 | 3300010391 | Freshwater Sediment | WAGVDNAWEQEKLEARKMLENSYSPHLSTARCVGPPVGIG* |
| Ga0136847_115850772 | 3300010391 | Freshwater Sediment | SVWEQKKLEARKMLENAAESHTSTARFVRRFSHQ* |
| Ga0138308_1110672 | 3300010965 | Lake Chemocline | VWAGVENVWEQENAEARKMLENAAESHTSGARFVGLLFVLAIIPC* |
| Ga0138308_1590482 | 3300010965 | Lake Chemocline | VWAGVDSVWEQEKPEARKMLENAAESHTSGARFVGTLLVFHNQFI* |
| Ga0138308_1716063 | 3300010965 | Lake Chemocline | AGWDNAWEQKKPEARKMLVNRADSHKSGARFVRCG* |
| Ga0138308_1847441 | 3300010965 | Lake Chemocline | VWAGVDSAWEQKKLEARKMLVNRADSHTSTARFVGRR |
| Ga0138308_1928902 | 3300010965 | Lake Chemocline | MWVGVDSAWEQKKLKARKMLENRAESHMSGASFVGHGT* |
| Ga0139299_11528211 | 3300011007 | Basal Ice | EQEKPEARKMLVKRADSHKSGARFVRRLYALRLAG* |
| Ga0137333_10636611 | 3300011413 | Soil | GADVDSVWEQEKPEARKMVMNGGESHLPSARCVGC* |
| Ga0137429_12537511 | 3300011437 | Soil | RVGGVDSVREQKKLEARNMLENAAESHTSGARFVGWHYLGE* |
| Ga0137328_10047641 | 3300012113 | Soil | VWAGVDSAWEQEKPEAKQKLKNAAESPASGARIVT |
| Ga0137347_10415192 | 3300012152 | Soil | VDSVWEQQKLEARKMLENAAKSHTSGARFVRRRFIFTYMV |
| Ga0137349_10167311 | 3300012160 | Soil | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGWL |
| Ga0137357_10085652 | 3300012168 | Soil | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGWHYLGE* |
| Ga0137459_10857142 | 3300012228 | Soil | GSGVDSAWEQKKLNARKLLENAPESPASSARFVSPLFGFA* |
| Ga0138256_103123891 | 3300012533 | Active Sludge | VWAGVDSAWEQEKPEARKMPENAAESHTSGARFVGLPLCKTRV* |
| Ga0138256_107038321 | 3300012533 | Active Sludge | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVS |
| Ga0138256_111848691 | 3300012533 | Active Sludge | WAGVDKVWEQEKLEARKMLVKRAASHPSAARFVGRLCARRAD* |
| Ga0138256_113811251 | 3300012533 | Active Sludge | VWAGVDSAWEQEKLEARKILENAAESHKSGARFVGWRLH* |
| Ga0157216_101878622 | 3300012668 | Glacier Forefield Soil | AGVDNAWEQEKLEARKMLENAAESHTSGARCVRCGFV* |
| Ga0137337_10062131 | 3300012675 | Soil | VDSVLEQEKLEARKMPENAAESHTSGARFVRRDLGKKN* |
| Ga0137341_10598561 | 3300012676 | Soil | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVVPQL |
| Ga0153915_107471042 | 3300012931 | Freshwater Wetlands | VWAGVDSVWEQKKPEARKLLEIAAESHTSGARFVGRFLLRQAL* |
| Ga0153915_126403841 | 3300012931 | Freshwater Wetlands | VDNAWEQEKPEARKMLENAAEFPASGVRFVGALIGLTTPAQV* |
| Ga0154020_107254202 | 3300012956 | Active Sludge | MGVDSAWEQEKLEARKMLLNRADSHTSGARFVGWRGLA* |
| Ga0163200_10175283 | 3300013088 | Freshwater | VDNAWEQEKPEARKMLENGDESHLSSARFVRRFFTMD |
| Ga0163209_12398741 | 3300013090 | Freshwater | TCVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVRQ* |
| Ga0163210_12329922 | 3300013091 | Freshwater | VWAGVDSVWEQEKLEARKMPENAAESHTSGARFVRRCLTLR |
| Ga0163199_10641053 | 3300013092 | Freshwater | AGVDSVWEQKKLEARKMFEKAAESPASSARFVRRFCY* |
| Ga0163199_11127193 | 3300013092 | Freshwater | VWAGVDSAWEQKKLEARKMLENAAESHTSGARFVNPLFALM* |
| (restricted) Ga0172368_100061872 | 3300013123 | Freshwater | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGRL* |
| (restricted) Ga0172368_100134792 | 3300013123 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVSPLFAF* |
| (restricted) Ga0172368_100311734 | 3300013123 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVRRLFGKL* |
| (restricted) Ga0172368_100387482 | 3300013123 | Freshwater | VWVGVDNAWEQGKLEARKMLENAAESHTSGARFVGQPLR* |
| (restricted) Ga0172368_100448605 | 3300013123 | Freshwater | VWAGVDKDWEQKKLEARKMPENAADSHTSGARGVGQFLFIRQTL* |
| (restricted) Ga0172368_100467801 | 3300013123 | Freshwater | VWAGVDNDWKQEKLEARKMLENAAESHTSGARFVGWR |
| (restricted) Ga0172368_100471664 | 3300013123 | Freshwater | VWAGVDSAWEQEKLEGRKILENAAESHTSGARFVSRLFA* |
| (restricted) Ga0172368_100483785 | 3300013123 | Freshwater | VDNAWEQEKLEARKMLENAAESHTSGARFVRRFFVLT* |
| (restricted) Ga0172368_100580644 | 3300013123 | Freshwater | VWAGVDSAWEQEKLEARKTLENAADSHTSGARFVSLRTGNCKPLL* |
| (restricted) Ga0172368_100605994 | 3300013123 | Freshwater | VWAGVDSVWEQEKLEARKMLENAPESHTSGARFVGLLLC* |
| (restricted) Ga0172368_100662324 | 3300013123 | Freshwater | VDNAWEQEKLEARKILENAAESHTSGARFVGTLLT* |
| (restricted) Ga0172368_101090193 | 3300013123 | Freshwater | VWVGVDSAWEQKKLEARKMLENAAESHTSGARFVGWRGT* |
| (restricted) Ga0172368_101098181 | 3300013123 | Freshwater | VWAGVDNAWKQGKLEARKMLENAAESHTSGARFVVP |
| (restricted) Ga0172368_101121002 | 3300013123 | Freshwater | VWVGVDNTWEQEKLKARKMLENAAESHTSGARFVGQ |
| (restricted) Ga0172368_101299603 | 3300013123 | Freshwater | VCVTCVWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGQFL* |
| (restricted) Ga0172368_101494992 | 3300013123 | Freshwater | VWVGVDNAWEQEKLEARKMLENAAESHTSGARCVRW |
| (restricted) Ga0172368_102034801 | 3300013123 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVSL |
| (restricted) Ga0172368_102627521 | 3300013123 | Freshwater | VWAGVDSVWEQEKLEARKMLENAAESHTSGAPFV* |
| (restricted) Ga0172368_102682982 | 3300013123 | Freshwater | WAGVDSVWEQEKLEARKMLENAAESHTSGARFVGRC* |
| (restricted) Ga0172368_103304522 | 3300013123 | Freshwater | WEQDKLEARKMLENAAESHTSGARFVGRFWLCKTRLL* |
| (restricted) Ga0172368_104104571 | 3300013123 | Freshwater | VDNAWEQEKPEARKMPENAADSHTSGARCVRRRFES* |
| (restricted) Ga0172368_104453912 | 3300013123 | Freshwater | VWEGVDNAWEQEKLEARKMLENAAESHTSGARFVR |
| (restricted) Ga0172368_104593231 | 3300013123 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGQPL* |
| (restricted) Ga0172369_100630603 | 3300013125 | Freshwater | VWAGVDNAWEQEKPEARKMLENAAESHTSGARFVSRWLANIF* |
| (restricted) Ga0172369_100738325 | 3300013125 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVRPRHRFSDSTVFLKDLL |
| (restricted) Ga0172369_100803731 | 3300013125 | Freshwater | VDSAWEQEKLEARKIPENAAESHTSGARFVSPRPFCKTHC* |
| (restricted) Ga0172369_100807282 | 3300013125 | Freshwater | VWAGVDSVWEQEKLEAWKMLENAAESHTSGARFVGLLFAL* |
| (restricted) Ga0172369_101336782 | 3300013125 | Freshwater | VWAGVNSAWEQEKLEARKMLENAAESHTSGARCVGQFYL* |
| (restricted) Ga0172369_101350953 | 3300013125 | Freshwater | VWAGVDSVREQKKLEARKMLENAAESHTSGARFVGQFFIDKT |
| (restricted) Ga0172369_101352263 | 3300013125 | Freshwater | WAGVDNAWEQEKLEARKMLENAAESHTSGARFVRLVIV* |
| (restricted) Ga0172369_101624802 | 3300013125 | Freshwater | VDNAWEQGKLEARKMLENAAESHTSGARFVGQFLWFRN* |
| (restricted) Ga0172369_101625251 | 3300013125 | Freshwater | VTCVWAGVDNVREQEKLEARKMLENAAESHTSGARFVGCVLV* |
| (restricted) Ga0172369_101792742 | 3300013125 | Freshwater | VWAGVDKVWEQEKLEARKMLLNRADSHTSGARFVS |
| (restricted) Ga0172369_102246782 | 3300013125 | Freshwater | WAGVDSAWEQEKLEARKMLLNRADSHTSGARFVGHGLWKTLLLL* |
| (restricted) Ga0172369_102364013 | 3300013125 | Freshwater | VTCVWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGQFL* |
| (restricted) Ga0172369_102447301 | 3300013125 | Freshwater | VTCVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGQPAC* |
| (restricted) Ga0172369_102548683 | 3300013125 | Freshwater | TCVWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGLR* |
| (restricted) Ga0172369_102849333 | 3300013125 | Freshwater | GVDNAWEQGKLEARKMLENAAESHTSGARFVGQPLR* |
| (restricted) Ga0172369_102964182 | 3300013125 | Freshwater | GVDKVWEQEKLEARKMLENAADSHTSGARFVGTLLVCK* |
| (restricted) Ga0172369_103929364 | 3300013125 | Freshwater | VWAGVDSAWEQEKLEARKMLENAADSHTSGARFVS |
| (restricted) Ga0172369_104531981 | 3300013125 | Freshwater | VDKDWEQEKLEARKMLENAAESHTSGARGVGQFLFIRQTL* |
| (restricted) Ga0172369_104993151 | 3300013125 | Freshwater | VWAGVDNVWEQEKLEARKILENAAESHTSGARCVGRIIYQDSL* |
| (restricted) Ga0172369_105106642 | 3300013125 | Freshwater | TCVWAGVDNVWEQEKLEARKMLLNRADSHTSGVSMK* |
| (restricted) Ga0172369_105513011 | 3300013125 | Freshwater | VTCVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGQPANQNAG* |
| (restricted) Ga0172367_100043437 | 3300013126 | Freshwater | GVDNVWEQRKLEARKMLENAAESHTSGARFVGWRFISQTII* |
| (restricted) Ga0172367_100302214 | 3300013126 | Freshwater | VWAGVDKAWEQEKLEARKMLENAAESHTSGARFVGTLL |
| (restricted) Ga0172367_100307472 | 3300013126 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGQPACLPERWLFR* |
| (restricted) Ga0172367_100528613 | 3300013126 | Freshwater | VWAGVDNVWEQEKLEARKILENAAESHTSGARFVGTLLTLRDLCF* |
| (restricted) Ga0172367_100528615 | 3300013126 | Freshwater | VWAGVDKDWEQEKLEARKILENRADSHTSGARFVSPLL |
| (restricted) Ga0172367_101042691 | 3300013126 | Freshwater | VWAGVDNAWEQGKLKARKMLENAAESHTSAARFVGLRLLETL* |
| (restricted) Ga0172367_101250022 | 3300013126 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHMSGARFVGQPL* |
| (restricted) Ga0172367_101258901 | 3300013126 | Freshwater | VWAGVDNAWEQENAEARKMLENAAESHTSGARFVRQPAR* |
| (restricted) Ga0172367_101258903 | 3300013126 | Freshwater | VWAGVDNAWEQKKLEARKMLENAAESHTSGARFVGRILWDEL* |
| (restricted) Ga0172367_101288952 | 3300013126 | Freshwater | VWVGVDNAWEQEKLEARKMLENGADSHTSGARFVGRCQPYRPNDC* |
| (restricted) Ga0172367_101487863 | 3300013126 | Freshwater | VWAGVDNAWEQKKLKARKMPENAAESHTSGARFVGRA* |
| (restricted) Ga0172367_101883493 | 3300013126 | Freshwater | VWAGVDNAWEQEKLEARKIIENAAESHTSGARFVGWLCARRAD* |
| (restricted) Ga0172367_102023093 | 3300013126 | Freshwater | VWAGVDNAREQEKLEARKMLENAAESHTSGARFVGWLCARRAD* |
| (restricted) Ga0172367_102881802 | 3300013126 | Freshwater | VWAGVDSVWEQKKLEARKMPENAAESHTSGARFVRRNLKQA |
| (restricted) Ga0172367_103030482 | 3300013126 | Freshwater | VWAGVDNAWEQEKLEARKMLENAADSHTSGARFVGWRFCHK* |
| (restricted) Ga0172367_103341482 | 3300013126 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGRCCWKDHIV* |
| (restricted) Ga0172367_103363232 | 3300013126 | Freshwater | VWAGVDKVWEQEKLEARKILENAAESHTSGARFVGTLFALQC* |
| (restricted) Ga0172367_103371442 | 3300013126 | Freshwater | VWAGVDSVWEQEKLKARKMLENAAESHTSGARFVGWRGT* |
| (restricted) Ga0172367_104344852 | 3300013126 | Freshwater | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGTLLTLRRYTDFSVISK* |
| (restricted) Ga0172367_104933591 | 3300013126 | Freshwater | VWAGVDSAWEQKKLDARKMLENAADSHTSGARFVGTLLDF |
| (restricted) Ga0172367_105251872 | 3300013126 | Freshwater | VDSAWEQEKLEARKKPVNRADSHTSGARFVSPFLTYGTSAVFI |
| (restricted) Ga0172367_105588441 | 3300013126 | Freshwater | VWAGVDNAWEQGKLEARKMLENAAESHTSGARFVGRHYESQTPC* |
| (restricted) Ga0172367_105626781 | 3300013126 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVRWL |
| (restricted) Ga0172367_106861982 | 3300013126 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGAPFV* |
| (restricted) Ga0172373_100243029 | 3300013131 | Freshwater | VWAGVDNAWEQEKLKARKMPENAAESHTSGARFVGQRFANYV* |
| (restricted) Ga0172373_100521225 | 3300013131 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRFL* |
| (restricted) Ga0172373_101357214 | 3300013131 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESPASGARFVTRM* |
| (restricted) Ga0172373_101424671 | 3300013131 | Freshwater | CVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVRRLFLSQ* |
| (restricted) Ga0172373_101455611 | 3300013131 | Freshwater | VWVGVDSAWEQEKPEARKMLENAAESHTSGARFVGWRFMGA* |
| (restricted) Ga0172373_102576132 | 3300013131 | Freshwater | VWAGVDSLWEQEKLEARKMLENAADSHTSGARFVR |
| (restricted) Ga0172373_102941031 | 3300013131 | Freshwater | VWAGVDNAWEQENAEARKMLENAAESHTSGGRFDGQFLTSRLTCYQK |
| (restricted) Ga0172373_105702121 | 3300013131 | Freshwater | CVWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGQPAC* |
| (restricted) Ga0172373_106195642 | 3300013131 | Freshwater | VWAGWDSAWEQEKLEARKMLENAADSHTSGARFVGTLLTLRRLI |
| (restricted) Ga0172372_100344754 | 3300013132 | Freshwater | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGTLLTFGNFF* |
| (restricted) Ga0172372_100502935 | 3300013132 | Freshwater | TCVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGQFLTLRLTCY* |
| (restricted) Ga0172372_102066971 | 3300013132 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGLRFL |
| (restricted) Ga0172372_104049051 | 3300013132 | Freshwater | GVDNAWEQEKLEARKMLENAADSHTSGARFVGRWLN* |
| (restricted) Ga0172372_106089012 | 3300013132 | Freshwater | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVRP |
| (restricted) Ga0172372_107503171 | 3300013132 | Freshwater | VWAGVDNAWEQEKPEARKMPENAAESHTSGARFVGQPA |
| (restricted) Ga0172362_104567772 | 3300013133 | Sediment | VWAGVDNAWEQKKLEARKMLENRADSHTSGARFVVP |
| (restricted) Ga0172362_107729841 | 3300013133 | Sediment | VWAGVDNAWEQYKPEARKVPENAAESHTSGARFVRRRLV |
| (restricted) Ga0172370_101059604 | 3300013136 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVS |
| (restricted) Ga0172370_101076161 | 3300013136 | Freshwater | VWAGVDNAWKQEKLEARKMLENAAESHTSGARFVGWR |
| (restricted) Ga0172370_101210361 | 3300013136 | Freshwater | VWAGVDKVWEQEKLEARKILENAAESHTSGARFVGTL |
| (restricted) Ga0172370_101267734 | 3300013136 | Freshwater | WAGVDSAWEQEKLEARKMLENAAESHTSGARFVRRIFILHTLW* |
| (restricted) Ga0172370_101289254 | 3300013136 | Freshwater | TCVWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGQFL* |
| (restricted) Ga0172370_101674801 | 3300013136 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGWR* |
| (restricted) Ga0172370_101762753 | 3300013136 | Freshwater | CVTCVWAGVDSLWEQEKLEARKMLENAAESHTSGARFVGTLFA* |
| (restricted) Ga0172370_101901252 | 3300013136 | Freshwater | VWAGVDNVWEQEKLEARKILENAAESHTSGARFVGTLFALQC* |
| (restricted) Ga0172370_102125671 | 3300013136 | Freshwater | VWAGVDSAWEQKKLEARKMLENGADSHTSGARFVGRV |
| (restricted) Ga0172370_102134531 | 3300013136 | Freshwater | VDSAWEQEKLEARKMLENAAESHTSGARCVRRVLFD* |
| (restricted) Ga0172370_102221741 | 3300013136 | Freshwater | VTCVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVSLLLTLETH* |
| (restricted) Ga0172370_102223821 | 3300013136 | Freshwater | VWAGVDNAWEQGKLEAWKMPENAAEAHTSGARFVS |
| (restricted) Ga0172370_102230451 | 3300013136 | Freshwater | VWAGVNNAWDQEKLEARKMLENAPESHTSGARFVGTLFAYRLHSQREIDAT* |
| (restricted) Ga0172370_102443211 | 3300013136 | Freshwater | VWAGWDSVWEQEKLEARKMLENAAESHTSGARFVG |
| (restricted) Ga0172370_102996651 | 3300013136 | Freshwater | VDNAWEQEKLEARKMLENAAESHTSGARFVRLVIV* |
| (restricted) Ga0172370_103383462 | 3300013136 | Freshwater | WAGVDSAWEQEKLEARKMLENAAESHTSGARFVRRLFGKL* |
| (restricted) Ga0172370_103755341 | 3300013136 | Freshwater | VWAGVDKVWEQEKLKARKMLENAAESHTSGARFVGCWMNARL |
| (restricted) Ga0172370_103788243 | 3300013136 | Freshwater | WAGVDNAWEQEKLEARKMLENAAESHTSGARFVRHGRT* |
| (restricted) Ga0172370_104754182 | 3300013136 | Freshwater | WEQEKLEARKMLENAAESHTSGARFVGQPACLPKP* |
| (restricted) Ga0172375_101517421 | 3300013137 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVTRM* |
| (restricted) Ga0172375_102844512 | 3300013137 | Freshwater | AGVDSAWEQEKLEARKMLENAAESPASSARFVGRVTE* |
| (restricted) Ga0172375_106625962 | 3300013137 | Freshwater | VWAGVNNVREQEKLEARKMLAVGAAESHTSGARFVR |
| (restricted) Ga0172375_109732822 | 3300013137 | Freshwater | VWAGLDSVWEQRKLEARKMLENAAESHTSGARFVS |
| (restricted) Ga0172371_100730126 | 3300013138 | Freshwater | WAGVDSAWEQEKLEARKMLENAAESHTSGARFVSPLFAF* |
| (restricted) Ga0172371_100744166 | 3300013138 | Freshwater | VWVGVDKVWEQEKLEARKMLVNRAESHLSGARFVSLLLTLRLTCQT* |
| (restricted) Ga0172371_101685443 | 3300013138 | Freshwater | AGVDSVWEQEKLEARKMLENAPESHTSGARFVGLLLC* |
| (restricted) Ga0172371_102641192 | 3300013138 | Freshwater | VDSVWEQEKLEARKMLENAAGSHTSGARFVGWLFAIS* |
| (restricted) Ga0172371_102704203 | 3300013138 | Freshwater | VDSAWEQKKLEARKILENAAESHTSGARFVSLLLTLETH* |
| (restricted) Ga0172371_103873771 | 3300013138 | Freshwater | VDNVWEQEKLEARKMLENAADSHTSGARFVGRRYFNGTLA* |
| (restricted) Ga0172371_105437442 | 3300013138 | Freshwater | VWAGVDSAWEQKKLEARKILENAAESHTSGARFVSLLFAFRGFP* |
| (restricted) Ga0172371_105856331 | 3300013138 | Freshwater | VWAGVDNAWEQKKLEARKILENAAESHTSGARFVG |
| (restricted) Ga0172371_106344402 | 3300013138 | Freshwater | VWVGVDNAWEQGKLEARKMLENAAESHTSGARFVG |
| (restricted) Ga0172371_106544401 | 3300013138 | Freshwater | VWAGVDKVWEQEKLEARKILENAAESHTSGARFVGTLLT |
| (restricted) Ga0172371_106983592 | 3300013138 | Freshwater | AWEQEKPEARKMLENAAESHTSGARFVSRWLANIF* |
| (restricted) Ga0172371_107855722 | 3300013138 | Freshwater | WAGVDNAWEQEKLEARKMLENAADSHTSGARFVGRWLN* |
| Ga0120188_10113532 | 3300013760 | Terrestrial | VWAGVDNAWEQEKLEARKMPENAAESHTSGARFVGR |
| Ga0119891_1055802 | 3300014023 | Wastewater | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGLLFAYGA* |
| (restricted) Ga0172376_100955651 | 3300014720 | Freshwater | AGVDNAWEQEKLEARKMLENAAESHTSGARFVGQFLTLRLTCY* |
| (restricted) Ga0172376_101812182 | 3300014720 | Freshwater | VWAGVDSAWEQEKLEARKMPKNAAESHTSGARFVSLLLSL* |
| (restricted) Ga0172376_103687561 | 3300014720 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGQPACLPKP* |
| (restricted) Ga0172376_104403051 | 3300014720 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGQFLT |
| Ga0182027_100354783 | 3300014839 | Fen | VWAGEDSVWEQEKPEARKMLENAAESHTSGARFVGTLLTFREPI* |
| Ga0180086_10838731 | 3300014883 | Soil | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVSPFLVN* |
| Ga0180067_10277202 | 3300015257 | Soil | VWAGVDSVWEQDKLEARKMLENAAESHTSGARFVGWHYLGE* |
| Ga0180067_11130731 | 3300015257 | Soil | VWAGVDSVWEQKELEARKMLVKRAESHTSGARFVGTL |
| Ga0184638_10770461 | 3300018052 | Groundwater Sediment | VWAGVDSIREQEKLEAKKMLVNRADSHTSGARFVRCGFV |
| Ga0184626_100745761 | 3300018053 | Groundwater Sediment | AGVRGVDNVWEQYKLEARKLLQNGDESHLSSACFVRRRGMG |
| Ga0184616_104048573 | 3300018055 | Groundwater Sediment | VWVGVDNAWEQEKLKARKMLENSYSTHTSTARFVGRTADL |
| Ga0184615_100056051 | 3300018059 | Groundwater Sediment | VWAGVDSAWEQEKLEARKMPKNAAESHTSGARFVRRL |
| Ga0184615_100425501 | 3300018059 | Groundwater Sediment | AGVDSVWEQEKPEARKMLENAAESPASGARFVSPPPSWN |
| Ga0184615_100923133 | 3300018059 | Groundwater Sediment | VWAGVDSVWEQEKLEARKMPENAAESHTSGARFVRRDLGKKN |
| Ga0184615_101311573 | 3300018059 | Groundwater Sediment | DSVWEQEKLEARKMLENAADSHTSGARCVGQRQNG |
| Ga0184615_102520172 | 3300018059 | Groundwater Sediment | VDNVWEQKKLEARKMLLNRADSHTSGARFVSRRLW |
| Ga0184615_104779082 | 3300018059 | Groundwater Sediment | VWAGVDNAWEQEKLKARKMLAAGAAESHTSGARFVSQRFNRYPKH |
| Ga0184639_103601301 | 3300018082 | Groundwater Sediment | MAHLLADVDSVWEQEKPEARKMLENGDDSHLSSAPP |
| Ga0184639_103883121 | 3300018082 | Groundwater Sediment | VDSAWEQEKPEARKMIENAAESHKSTARFVGLRHHLKMT |
| Ga0193739_10691301 | 3300020003 | Soil | MWAGVDSVWEQEKPEARKMFVKRADSHTSDARSVGWLLRH |
| Ga0194113_105922083 | 3300020074 | Freshwater Lake | VWAGVDNAWEQEKAEARKMLLNRAESHTSGARFVG |
| Ga0194113_109184562 | 3300020074 | Freshwater Lake | VWAGVDNAWEQGKLEARKMLENAAESHTSGARFVGTLLTL |
| Ga0194111_100823683 | 3300020083 | Freshwater Lake | VWASVDNAWEQEKLEARKMLENAAESHTSGAPKMRAR |
| Ga0194111_105977802 | 3300020083 | Freshwater Lake | VWAGVDSAWEQKKLEARKMLENAAESHTSGARFVS |
| Ga0194120_101754081 | 3300020198 | Freshwater Lake | VWAGVDSVREQGKLEARKMLENAAESHTSGARFVGRFS |
| Ga0194120_101776114 | 3300020198 | Freshwater Lake | VWAGWDSAWEQEKPEARNMLENAAESHTSGARFVGTLLTFEDSPA |
| Ga0194119_105395611 | 3300020220 | Freshwater Lake | SCVWAGVDSAWEQYKLEARKILENAADSHTSGARFVRPRS |
| Ga0194119_106055261 | 3300020220 | Freshwater Lake | GWDSVWEQGKLEARKMLENAAESHTSGARFVRRRFCRQEPMLL |
| Ga0194127_102283892 | 3300020221 | Freshwater Lake | VWASVDNAWEQEKLEARKMLENAAESHTSGAPKMR |
| Ga0194127_103439651 | 3300020221 | Freshwater Lake | GVDSVWEQEKLEARKMPENAAESHTSGARFVSPLFF |
| Ga0194129_100537393 | 3300020578 | Freshwater Lake | VWAGVDSAWEQEKLEARKMPKNAAESHTSGARFVNLLLSL |
| Ga0194126_102535923 | 3300020603 | Freshwater Lake | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRFLALRHL |
| Ga0194126_103592442 | 3300020603 | Freshwater Lake | WAGVDSVWEQEKLEARKMPENAAESHTSGARFVSPLFF |
| Ga0210377_100333452 | 3300021090 | Groundwater Sediment | VWAGVDSVWEQKKLEARKMLENAAESHTSGARFVSPLFGFA |
| Ga0210377_100828541 | 3300021090 | Groundwater Sediment | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVRHGR |
| Ga0210377_102871882 | 3300021090 | Groundwater Sediment | VWAGVDNVWEQKKLEARKMLENAAESHTSGARFVS |
| Ga0210377_104958942 | 3300021090 | Groundwater Sediment | VCVTCVWAGVDNAWEQKKLEARKMLENAAESHTSGARFVGQF |
| Ga0210377_105276862 | 3300021090 | Groundwater Sediment | VDNVWGQKKLKARKMLENAAESPASSARCVGQFTELKTQ |
| Ga0190329_10481322 | 3300021494 | Hydrothermal Vent Sediment | VDSAWEQEKLEAKKLLENAAESHLSGARFVGRSLLRNI |
| Ga0190327_10098822 | 3300021505 | Hydrothermal Vent Sediment | VDSAWEQEKLEAKKLLENAAESHLSGARFVGRSLLRKI |
| Ga0226835_10116103 | 3300021604 | Anaerobic Bioreactor Biomass | VWAGVDNAWEQGKLKARKMLENAAESHTSGARFVSLRLFL |
| Ga0226835_10138313 | 3300021604 | Anaerobic Bioreactor Biomass | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVSPFLF |
| Ga0226835_10198552 | 3300021604 | Anaerobic Bioreactor Biomass | VWVGVDSAWEQEKLEARKMLENAAESHTSGARFVRRSFARAF |
| Ga0232057_13612573 | 3300021970 | Anaerobic Bioreactor Biomass | VWAGVDNAWEQEKLEARKMPENAAESHTSGARFVS |
| Ga0232064_1144371 | 3300022151 | Anaerobic Bioreactor Biomass | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVSPFFIDTATLPI |
| Ga0224511_103491362 | 3300022205 | Sediment | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVSLL |
| Ga0224495_100469213 | 3300022208 | Sediment | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGQVL |
| Ga0224495_101809372 | 3300022208 | Sediment | RKWVGVDTAWEQEKPETRKLLVNRADSRASGARFVGWLSC |
| Ga0212093_10797163 | 3300022554 | Hot Spring Sediment | VWAGEDNAWEQEKLEARKMLENAAESHTSGARFVGQRAC |
| Ga0212121_101250903 | 3300022556 | Anoxic Lake Water | VWAGVDSAWEQEKLEARKILENAAESHTSGARFVSPLFAFK |
| Ga0212121_103498023 | 3300022556 | Anoxic Lake Water | VWAGVDNAWEQKKLEARKMLENAAESHTSGARFVSPFLI |
| Ga0212121_106668072 | 3300022556 | Anoxic Lake Water | VTCVWAGVDNAWEQEKLEARKMLENAAESHTSGARFVRQ |
| Ga0256614_10839151 | 3300023201 | Activated Sludge | VWVGVDNAWEQGKLEARKMLENAAESHTSGARFVGL |
| (restricted) Ga0233424_101791242 | 3300023208 | Freshwater | VWAGVDSAWEREKLEVWKMLENAVESHTSGARFVGRLLVKS |
| Ga0255842_12834091 | 3300023211 | Activated Sludge | CVWAGMDSVWEQEKLEARKMPVNRADSQPSAARGVGWLCARPAG |
| Ga0224535_10636662 | 3300023258 | Soil | VWAGEDSVWEQEKPEARKMLENAAESHTSGARFVGTLLTFREPI |
| (restricted) Ga0233425_101796362 | 3300024054 | Freshwater | VWAGVDKAWEQEKPEARKMLENGAESHTSGARFVG |
| (restricted) Ga0233420_100196806 | 3300024300 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVR |
| (restricted) Ga0233420_101965571 | 3300024300 | Freshwater | VWAGVDNAWEQEKLEAWKMLENAAESQTSGARFVRRRLTLTQLYFPDFLR |
| (restricted) Ga0233421_100054901 | 3300024341 | Freshwater | VWAGVDSAWEQKKLEARKMLENAAESHTSGARFVWHGL |
| Ga0210023_10403893 | 3300025014 | Aquifer | DNVWEQEKLEARKMLENAAESHQSAARFVGTLFVMERL |
| Ga0210024_10473301 | 3300025031 | Aquifer | NVWEQEKLEARKMLENAAESHQSAARFVGTLFVMERL |
| Ga0208863_10740793 | 3300025107 | Soil | VTCVWAGVDSVWEQEKLEARKMLVNRADSHTSVARFVGWRFSF |
| Ga0209835_10838271 | 3300025115 | Anoxic Lake Water | QEKIEARKMLLNRADSHTSGARFVRPLFAFEDSLA |
| Ga0209498_12314942 | 3300025135 | Sediment | VWAGVDSAWEQEKPDARKMLENAAESHIICARFVGRFWD |
| Ga0209521_101042913 | 3300025164 | Soil | VWAGVDNAWEQEKLEARKMPENAAESHTSGARFVSWLLF |
| Ga0209521_102134263 | 3300025164 | Soil | VDNVWEQEKPEARKMLVNRAESHTSGARFVGTLFAM |
| Ga0209324_104843241 | 3300025174 | Soil | VWAGWDNVWEQEKPEARKMLENAAESHTSGARFVGQLHDC |
| Ga0208047_10933482 | 3300025279 | Freshwater | VWAGVDSVREQEKLEARKMLENAAESHTSGARFVG |
| Ga0209002_101255261 | 3300025289 | Soil | WAGVDNAWEQEKLEARKMLKNSYSAHLSTARHVGRTAGL |
| Ga0209172_102308471 | 3300025310 | Hot Spring Sediment | VWAGVDSVWEQENAEARKMLENAAESHTSGARFVSLLLAWN |
| Ga0209431_103066703 | 3300025313 | Soil | VWAGVDNVWEQEKPEARKMLVNRAESHTSGARFVGTLFAM |
| Ga0209431_106263881 | 3300025313 | Soil | GVDAVWEQKKPEARKMPEKRADSHLSGARCVSLRQWS |
| Ga0209431_108382772 | 3300025313 | Soil | VWAGVDSVWEQEKPEARKMLENAAESHTSGGRVKG |
| Ga0209519_105797001 | 3300025318 | Soil | VWASVENVREQKKLEARKMLENAAESHTSGARFVRRW |
| Ga0209341_100786832 | 3300025325 | Soil | VWAGVDSVWDQKKLEARKMLENAAESHTSGARFVGWLYARLAG |
| Ga0209751_110434741 | 3300025327 | Soil | VWAGVDSVWEQEKPEARKMLENAAESHTSGARFDGRIL |
| Ga0208695_10978571 | 3300025678 | Anaerobic Digestor Sludge | VWAGVDSVREQKKLEARKMLENAAESYTSGAHFVSRLFPLRKTL |
| Ga0209201_10358483 | 3300025708 | Anaerobic Digestor Sludge | VWAGVDSAWEQETLEARKMPENAAESHTSGARFVGQF |
| Ga0208828_10356602 | 3300025807 | Freshwater | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGRF |
| Ga0210016_10453501 | 3300025837 | Groundwater | VWAGVDNAWEQEKLEARKMLVNRAASHTSAARGVR |
| Ga0209182_100024249 | 3300025843 | Lake Sediment | VDNAWEQEKLEARKMLENGDESHLSSARFVSPLFA |
| Ga0210036_10137129 | 3300025844 | Aquifer | VDSVWEQEKLEARKMLENAAESHTSGARFVSPFLFCKTHF |
| Ga0209096_11703822 | 3300025859 | Anaerobic Digestor Sludge | VWAGVDNAWEQEKPEARKILENAAESHTSGARFVGQPACLPKP |
| Ga0209429_103712872 | 3300025864 | Arctic Peat Soil | VTGAGAGVDSVWEQKKLEARKMLENGDLSHLSSAP |
| Ga0209226_101626842 | 3300025865 | Arctic Peat Soil | VDSAWEQEKLEARKMFEKAAESPASSARMVGRPFALKDF |
| Ga0209540_100370693 | 3300025888 | Arctic Peat Soil | VWAGVDNAWEQKKPEARKMLENAAESPASSARFVGCV |
| Ga0207684_109914732 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDNAWEQRKLEARKMLENAAESHLSSARFVRRFLL |
| Ga0209018_10354242 | 3300026278 | Anoxygenic And Chlorotrophic Microbial Mat | VGVDSAGEQKKPEARKMLENGAESHHLAARFVGQFLS |
| Ga0209077_10144323 | 3300027675 | Freshwater Sediment | VWAGVDSAWEQEKPEARKMLEKPHRTPASNARFVGRDLGKKN |
| Ga0209285_101082501 | 3300027726 | Freshwater Sediment | RQPDSVWEQEKPEARKLLVNRAESPASGARCVSPF |
| Ga0209592_10895931 | 3300027731 | Freshwater Sediment | WAGLDSVWEQRKLEARKMLENAAESHTSGARFVSRRN |
| Ga0209575_100679241 | 3300027739 | Freshwater | DSLWEQKKLEARKMLENAAESHTSGARFVGLLHVKDTFIY |
| Ga0209288_101904982 | 3300027762 | Freshwater Sediment | VWAGVDSAWEQEKLEARKILENAAESHTSGARFVSPLPIF |
| Ga0209066_103480972 | 3300027851 | Watersheds | VWAGVDSVWEQKKLEARKMLENAAESHTSGARFVGRRCL |
| Ga0209481_104800881 | 3300027880 | Populus Rhizosphere | APSGYWWVGMDNAWKQYKPEARKTLENAARTRQSGARFVGRR |
| Ga0209450_100972982 | 3300027885 | Freshwater Lake Sediment | VGVDSAWEQEKPEARKLLENAAESPASSARGVGKIL |
| Ga0209450_104065662 | 3300027885 | Freshwater Lake Sediment | GVDSAWEQEKLEVRRMLDVGAADSHTSGARCVRRFYFF |
| Ga0209450_111786312 | 3300027885 | Freshwater Lake Sediment | VWAGVDSVWEQEKLEARKMLAVGAAREASHRSDARFVGW |
| Ga0208980_100699002 | 3300027887 | Wetland | VWAGLDSVWKQEKLEARKILENAADSHTSGARFVGWRFLEGSM |
| Ga0209254_102699323 | 3300027897 | Freshwater Lake Sediment | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGL |
| (restricted) Ga0233417_101422952 | 3300028043 | Sediment | DSAWEQEKPESRKKPENGTESHPSSARIVSRISEV |
| Ga0268283_12134872 | 3300028283 | Saline Water | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVR |
| Ga0302158_10661522 | 3300028645 | Fen | VDSAWEQEKLEARKILEYVAESPASSARFVSPHLA |
| Ga0272412_10117755 | 3300028647 | Activated Sludge | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVGRILPEPRFLT |
| Ga0272412_10472122 | 3300028647 | Activated Sludge | VWAGVDSVWKQEKLEARKMLENGAESHTSGARFVS |
| Ga0272412_12112162 | 3300028647 | Activated Sludge | VWAGVDSVREQEKLEARKMLENAAESHTSGARFVGRAYN |
| Ga0302161_100637651 | 3300028674 | Fen | VDSVREQEKLEARKLPEIAAESPASSARFVRRCLYVSLNLI |
| Ga0302206_10528671 | 3300028734 | Fen | RWAGVDNAWKQYKLEARKMLENAAESHTSTARFVRRV |
| Ga0272446_10010101 | 3300028735 | Microbial Mat | VDSAWEQEKPEARKMLENGAESHQSAARFVRRGLFLTNPFY |
| (restricted) Ga0233419_100520562 | 3300028737 | Freshwater | VWAGVDSAWEQEKPEARKMPENAAESHTSGARFVSP |
| Ga0268298_100160653 | 3300028804 | Activated Sludge | VWAGVDSAWEQGKLEARKMLENAAESHTSGARGVGRLLLRKTL |
| Ga0268298_100160659 | 3300028804 | Activated Sludge | VWAGVDNAWEQENAEARKMLENAAESHTSGARFVGQLLTFYLFD |
| Ga0268298_100262741 | 3300028804 | Activated Sludge | VWAGVDSAWEQEKPEARKMLENAAESHTSGARFVRRRV |
| Ga0268298_100400803 | 3300028804 | Activated Sludge | VWAGVDSVWEQRKLEARKMLENAAESHTSGARFVGRVVQETN |
| Ga0268298_100659581 | 3300028804 | Activated Sludge | VWAGVDSVWEQEKLEARKILENAAESHTSGARFVSLLLTLENLY |
| Ga0268298_100943363 | 3300028804 | Activated Sludge | VWAGLDSLWEQEKLEARKMPENAAESHTSGARFVR |
| Ga0268298_101008144 | 3300028804 | Activated Sludge | VDSVWEQKKLEARKMPENAAESHTSGARFVGWLCARHAD |
| Ga0268298_101011332 | 3300028804 | Activated Sludge | VWAGVDSAWEQEKLDARKMLENAAESHTSGARFVGWRL |
| Ga0268298_101257311 | 3300028804 | Activated Sludge | VWAGVDSAWEQEKLEARKMLENAAESHTSGARRVSPLFADKQPNL |
| Ga0268298_101627091 | 3300028804 | Activated Sludge | WAGVDSAWEQKKLEARKILENAAESHTSGARFVGCVFAFKVLS |
| Ga0268298_101935891 | 3300028804 | Activated Sludge | VWAGVDNAWEQEKLEARKMLENAAESHTSGARFVRRR |
| Ga0268298_102740112 | 3300028804 | Activated Sludge | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVG |
| Ga0268298_105579912 | 3300028804 | Activated Sludge | VDSVWEQEKLEARKILENAAESHTSGARFVSRVLLR |
| Ga0268298_105995412 | 3300028804 | Activated Sludge | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGQFC |
| Ga0268298_106302611 | 3300028804 | Activated Sludge | VWAGVDSVWEQEKLEARKMLVNAAESHTSGARFVSPFWDLARL |
| Ga0268298_106323992 | 3300028804 | Activated Sludge | VWAGVDNVWEQEKLEARKMLENAAESHTSGARFVSPLFSFQEH |
| Ga0119857_10531901 | 3300029304 | Anaerobic Bioreactor | AGVDSLWEQEKPEARKMLENAADSHTSGARFVSRRFC |
| Ga0246099_100004405 | 3300029890 | Groundwater | VWAGVDNVWKQEKLEARKMLENAAESHTSGARFVGWLLALRLILGYIKT |
| Ga0302271_103003271 | 3300029998 | Bog | VDSVWEQEKLEARKMLENAAESPASSARCVSLRFERHIL |
| Ga0311337_101259501 | 3300030000 | Fen | GAGAGVDSAWEQKKLEARKMLENAAESPASSARFVGQCFG |
| Ga0311337_106518572 | 3300030000 | Fen | VWVGVDNAWEQGKLEARKMLENAAESHTSGARFVGRVTANILLN |
| Ga0311337_106963822 | 3300030000 | Fen | VDSAWEQKKPEARKMLENAAESPASSARFVGWLLC |
| Ga0311337_107973113 | 3300030000 | Fen | TVDSAWEQKKLEARKMLVNRAESPASSARGVGRVFN |
| Ga0311337_117408042 | 3300030000 | Fen | AGVDSAWEQEKLEARKMLENAAESHTSGARFVSRRN |
| Ga0311350_105148392 | 3300030002 | Fen | VDSAWEQKKPEARKMLVNREDSHKPAACFFSRVLLQ |
| Ga0311348_102279131 | 3300030019 | Fen | VWAGVDNVWEQEKTEARKMLGNCADFQKSAAQFVRRFLL |
| Ga0311348_113788032 | 3300030019 | Fen | VDSAWKQEKLEARKLLENRAESPASSARFVGRFCV |
| Ga0311333_104161432 | 3300030114 | Fen | VGSVWEQKKLEARKMLENAADSPASSARFVGWRFVQDTKLL |
| Ga0311333_104775722 | 3300030114 | Fen | MDSALEQEKLEARKMLENAAESPASSARFVRRFSLVGI |
| Ga0299915_100049233 | 3300030613 | Soil | VWAGVDSAWEQEKLEDRKMLENAAESHTSGARFVGRLLP |
| Ga0299915_103023722 | 3300030613 | Soil | VDSAWEQEKLEARKMLGNGAESPASSARFVGRRFRRDDFA |
| Ga0311366_119533281 | 3300030943 | Fen | VDNVWEQEKTEARKMLGNCADSQKSAAHFVRRFLLR |
| Ga0302323_1013307791 | 3300031232 | Fen | VDSAWEQEKLEARKMLVNRTDSHTSGARFVRWWSIAVEFLV |
| Ga0302323_1025843551 | 3300031232 | Fen | AGVDSAWEQEKPEARKMLLNRADSHTSGARCVGRRLDE |
| Ga0311364_107650432 | 3300031521 | Fen | VDSAWKQEKLEARKMPENAAESPASSARFVGTLFV |
| Ga0247727_102739311 | 3300031576 | Biofilm | VWAGVDTVWEQENAEARKMLENRAESHTSGARFVRR |
| Ga0247727_103840442 | 3300031576 | Biofilm | VWAGVDSAWEQKKLEARKMLENAAESHTSGARFVSPLLD |
| Ga0247727_105876941 | 3300031576 | Biofilm | VWAGVDSVWEQEKPEARKILENAADSHTSGARFVGLRF |
| Ga0247727_106446961 | 3300031576 | Biofilm | VWAGVDSAWEQEKLEARKRLVKRGDSHTSGARFVGQL |
| Ga0247727_107336362 | 3300031576 | Biofilm | VWAGEDSAWEQEKLEAWKMLENAADSHTSGARFVGQFLIEQRLIG |
| Ga0247727_107407321 | 3300031576 | Biofilm | VWVGVDNVWEQEKLEAREMLENGDESHTSTARFVGWLFT |
| Ga0247727_108654702 | 3300031576 | Biofilm | VDNAWEQKKPEARKMLENAAESHTSGARFVRCGTD |
| Ga0307376_107202021 | 3300031578 | Soil | VDSVWEQRKFEARKMLENATESPASSACFVGRSLLRKA |
| Ga0311351_107918691 | 3300031722 | Fen | VTCVWAGVDNAWEQDAKRLEARKMLLNRADSHTSGARGVGWRFD |
| Ga0302321_1011197433 | 3300031726 | Fen | VDSAWAQKKPEARKMLENAAESPASSARFVGRFWD |
| Ga0302321_1019995922 | 3300031726 | Fen | VWAGVDNAWEQEKPEARKMLENAAESHTSGARFVGRFFLRKASC |
| Ga0315297_100367741 | 3300031873 | Sediment | TGKWAGVDNAWEQYELEARQLLGNGDESHLSSAGFVSPPTLR |
| Ga0315297_100799613 | 3300031873 | Sediment | VWAGVENIREQKKLEARKMLENGDESHTSTAHFVGTLFAM |
| Ga0315297_101720461 | 3300031873 | Sediment | VWAGVDSVWEQEKPEARKMLEMTAESHLSAARFVRRRGSY |
| Ga0214473_108655191 | 3300031949 | Soil | TRKWAGVDSAWEQKKLEARKLAVKRGDSHLSGARFVSPH |
| Ga0326597_107055902 | 3300031965 | Soil | GRWAGVDSAWEQEKLEARKMLENAAESHTSGARCVRCGFV |
| Ga0315278_114797052 | 3300031997 | Sediment | VAVGRAAGVDSAWEQEKLKATLREMLENRADSQKSGARFVSP |
| Ga0315272_102021211 | 3300032018 | Sediment | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVRRFFNL |
| Ga0315272_106637642 | 3300032018 | Sediment | VGVDSAWEQEKPEARKLLGNAAESPASSARFVGWRGLDNV |
| Ga0315289_105226353 | 3300032046 | Sediment | VWAGVDKAWEQRKLEARKMLKNGDESHLSSARFVSPLERLA |
| Ga0315284_111217822 | 3300032053 | Sediment | VDKDWEQEKLEARKLLKNGGESHLSSPRFVGRFCFARLYMF |
| Ga0315282_1000481119 | 3300032069 | Sediment | MSAGVDNVREQEKLEARKMPENAAESHLSSARFVSPFLT |
| Ga0315281_100443256 | 3300032163 | Sediment | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGTFLT |
| Ga0315281_103225712 | 3300032163 | Sediment | VWAGVDNAWEQKKLEARKMLENAAESHTSGARFVRQAGFG |
| Ga0315281_109424783 | 3300032163 | Sediment | GRDSLREAEKLEARKMLENRAESHTSAARFVGQFLT |
| Ga0315268_101185841 | 3300032173 | Sediment | VWAGVDSVWKQEKLEARKMLENGAESHTSGARFVRLLCGQ |
| Ga0315271_115124831 | 3300032256 | Sediment | AGGWVGVDSAWEQEKLEARKMLENGADSHPSAARFVGKN |
| Ga0315287_100512843 | 3300032397 | Sediment | MVCLAGKWAGLDYIWEQEKLNARLHEMLENAAESHTTGARIVGRY |
| Ga0315275_100079541 | 3300032401 | Sediment | VDNAWEQEKLEARKMLENGDESHLSSVRFVRPLIMI |
| Ga0315275_114794471 | 3300032401 | Sediment | VGVDKDWEQKKLEARKMLENAAESHPSASHFVSRLLA |
| Ga0335397_100600926 | 3300032420 | Freshwater | KWAGVDSAREQKKLEAWKMLEKPPTPHLSGARFVRQTR |
| Ga0335397_100935073 | 3300032420 | Freshwater | VDSAWKQKKLEARKMLENYAREASHLSDAGFVSRLFA |
| Ga0335397_101285292 | 3300032420 | Freshwater | VWAGVDNAWEQEKLEARKMPENAAESHTSGARFVSPLLVD |
| Ga0335397_101639611 | 3300032420 | Freshwater | VTRKWAGVDSARKQEKLEARKLFVKRADSHLSGARFVGRFLT |
| Ga0335397_101881941 | 3300032420 | Freshwater | VAGAGVDSAWEQEKLEARKMLENRADPHFICARFVGQFCAY |
| Ga0335397_102701203 | 3300032420 | Freshwater | VWAGVDSVWEQGKLEARKMLENAADSHTSGARFVR |
| Ga0335397_103678101 | 3300032420 | Freshwater | RKWACVDKDWEREKLEARKMLLNRADSHLSGARFVSHRFDI |
| Ga0335397_104125432 | 3300032420 | Freshwater | VDSAWEQEKPEARKMLENAAESHTSGARFVGQVLEDGF |
| Ga0335397_104277772 | 3300032420 | Freshwater | VWAGVDSAWEQEKLEAWKMLENAAESHTSGARFVSPLLFMD |
| Ga0335397_110692111 | 3300032420 | Freshwater | WAGVDNAWEQEKLEARKMPVNRADSHLSGARFVGQFFLARLTNQSRTCF |
| Ga0335394_105029031 | 3300032456 | Freshwater | VDSLWKQEKLEARKMLENRAESHLSGARFVRRGFMV |
| Ga0335394_108280892 | 3300032456 | Freshwater | VDSAWEQEKLEARKMLENRADSHLSGARFVGWRGLED |
| Ga0334722_101647992 | 3300033233 | Sediment | VWAGVDNAWEQKKLEARKMLENAAESHTSGARFVSLLAWFGF |
| Ga0316607_10286571 | 3300033415 | Microbial Mat | VWAGVDKAWEQEKLEARKMLENAAESYLSTARFEV |
| Ga0316625_1003027082 | 3300033418 | Soil | VWAGVDSVWEQEKPEARKMLENAAESHTSGARFVGLRVIQ |
| Ga0316625_1016480022 | 3300033418 | Soil | VWAGVDSAWEQKKLEARKMPEKAAESHPSGARCIGRLKLRVGG |
| Ga0316625_1021664001 | 3300033418 | Soil | VWAGVDSVWEQKKLEARKMLENAAESHTSGARFVGWRFWVETH |
| Ga0316608_11045201 | 3300033420 | Microbial Mat | TRVWVGVDNVWEQEKPEARKMLVNRAESHTSGARFVGWLCARLAD |
| Ga0316608_11334451 | 3300033420 | Microbial Mat | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGRI |
| Ga0316193_102645902 | 3300033429 | Sediment | VWAGVDSVWEQKKLEARKMLENAAESHTSGARFVGRY |
| Ga0326726_119563161 | 3300033433 | Peat Soil | RRERPQGAGVDSAWEQEKLEARKMLKNAAPYSARFVGRVTANILLN |
| Ga0316611_10083863 | 3300033446 | Microbial Mat | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVRRG |
| Ga0316611_10575363 | 3300033446 | Microbial Mat | VWAGVDNVWEQENAEARKMLENAAESHTSGARFVG |
| Ga0316611_10598321 | 3300033446 | Microbial Mat | NVWKREKLEARKLLENRAESPASGARFVRRGFIHQVLVR |
| Ga0316620_105966282 | 3300033480 | Soil | GVTCVWAGVDSVWEQKKPEARKLLEIAAESHTSGARFVGRFLLRQTL |
| Ga0316620_122246461 | 3300033480 | Soil | VDSVWEQKKPEARKLLEIAAESHTSGARFVGRFLLRQT |
| Ga0316627_1000795641 | 3300033482 | Soil | GRSVDSPPKRETLEARKMLENAAESHTSGARFVTRI |
| Ga0316627_1014201141 | 3300033482 | Soil | VWAGVDTVWEQEKLEARKMLENAAESHTSGARFVSPFLLITRPI |
| Ga0316627_1029821241 | 3300033482 | Soil | VWAGVDNAWEQEKLEARKMPENAAESHTSGARCIGRF |
| Ga0299912_105667842 | 3300033489 | Soil | VDNAWEQEKLEARKMLENGDESHLSSARFVRPLFA |
| Ga0316610_10633303 | 3300033498 | Microbial Mat | VWVGVDNVWEQEKPEARKMLVNRAESHTSGARFVGWLCARLAD |
| Ga0316610_10932121 | 3300033498 | Microbial Mat | VWEQEKLEARKMLENAAESHTSGARFVGRLFTRRLLCD |
| Ga0316610_11045961 | 3300033498 | Microbial Mat | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRRFASE |
| Ga0316616_1013291213 | 3300033521 | Soil | VWAGVDNAWEQGKLEARKMLENAAESHTSGARFVSHFP |
| Ga0316616_1018481152 | 3300033521 | Soil | VWAGVDKAWEQKKLEAWNMLENAAESHTSGARFVSPLYVL |
| Ga0316616_1033376681 | 3300033521 | Soil | VWAGVDSIREQEKLEARKMLENAAESHTSGARFVGRSLCLATK |
| Ga0316617_1025878601 | 3300033557 | Soil | VWAGVDSAWEQEKLEARKMLENAADSYTSGAHFVGQFF |
| Ga0316617_1026979602 | 3300033557 | Soil | VDSVWEQKKPEARKLLEIAAESHTSGARFVGRFLLRQTL |
| Ga0326723_0213727_715_837 | 3300034090 | Peat Soil | VDSVWEQKKLEARKMLENAAESHTSGARFVSLRFVEEAFL |
| Ga0364932_0165156_206_328 | 3300034177 | Sediment | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVGRRLLV |
| Ga0316609_037865_731_844 | 3300034627 | Microbial Mat | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRF |
| Ga0316609_093137_439_549 | 3300034627 | Microbial Mat | RVWAGVDSAWEQEKLKARKMLVNRADSHTSGARFVG |
| ⦗Top⦘ |