| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300033498 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129088 | Gp0344146 | Ga0316610 |
| Sample Name | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111B |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 281178297 |
| Sequencing Scaffolds | 21 |
| Novel Protein Genes | 23 |
| Associated Families | 13 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Perkinsozoa → Perkinsea → Perkinsida → Perkinsidae → Perkinsus → Perkinsus marinus | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa | 1 |
| All Organisms → cellular organisms → Bacteria | 3 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 1 |
| Not Available | 5 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 3 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp. | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → sinkhole → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 45.1993 | Long. (o) | -83.3279 | Alt. (m) | N/A | Depth (m) | 185 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000237 | Metagenome / Metatranscriptome | 1498 | Y |
| F002525 | Metagenome / Metatranscriptome | 552 | Y |
| F020197 | Metagenome / Metatranscriptome | 225 | Y |
| F036727 | Metagenome / Metatranscriptome | 169 | Y |
| F044511 | Metagenome / Metatranscriptome | 154 | Y |
| F045770 | Metagenome / Metatranscriptome | 152 | Y |
| F057919 | Metagenome / Metatranscriptome | 135 | Y |
| F064355 | Metagenome / Metatranscriptome | 128 | Y |
| F080961 | Metagenome / Metatranscriptome | 114 | Y |
| F081921 | Metagenome / Metatranscriptome | 114 | Y |
| F084884 | Metagenome / Metatranscriptome | 112 | Y |
| F085743 | Metagenome / Metatranscriptome | 111 | Y |
| F091749 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0316610_1006742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2785 | Open in IMG/M |
| Ga0316610_1013420 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Perkinsozoa → Perkinsea → Perkinsida → Perkinsidae → Perkinsus → Perkinsus marinus | 2016 | Open in IMG/M |
| Ga0316610_1024056 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1498 | Open in IMG/M |
| Ga0316610_1032357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa | 1279 | Open in IMG/M |
| Ga0316610_1041841 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| Ga0316610_1050843 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| Ga0316610_1050848 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| Ga0316610_1053080 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 962 | Open in IMG/M |
| Ga0316610_1060710 | Not Available | 885 | Open in IMG/M |
| Ga0316610_1061874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 875 | Open in IMG/M |
| Ga0316610_1063330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 862 | Open in IMG/M |
| Ga0316610_1068303 | Not Available | 823 | Open in IMG/M |
| Ga0316610_1074995 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 777 | Open in IMG/M |
| Ga0316610_1075252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 775 | Open in IMG/M |
| Ga0316610_1076697 | Not Available | 766 | Open in IMG/M |
| Ga0316610_1084553 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 720 | Open in IMG/M |
| Ga0316610_1094407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 672 | Open in IMG/M |
| Ga0316610_1097986 | Not Available | 656 | Open in IMG/M |
| Ga0316610_1104596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 629 | Open in IMG/M |
| Ga0316610_1111161 | Not Available | 605 | Open in IMG/M |
| Ga0316610_1114906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp. | 592 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0316610_1006742 | Ga0316610_10067421 | F020197 | MAEENDLNSKPFSMGYVLRTTAKHMRKSVDISIRKTFERIAEFEEDKEKSKEIFETLSVLHGMRKQIDDFQLENQLKFKGA |
| Ga0316610_1013420 | Ga0316610_10134201 | F085743 | KDLLMKVMTHLXDVKMIKDKTFSEIDPMKLTVVLLKKHGVSPEEDLLIDLENMKTRLVEVSENALGPVKEQILPLQKI |
| Ga0316610_1024056 | Ga0316610_10240561 | F084884 | LGILARFQAFFYALAFFQSDGVPPPAPARVTQTVRPPLAKLVFYNK |
| Ga0316610_1032357 | Ga0316610_10323571 | F084884 | VHPTLGILARFQAFFYASAFPQSDGVPPPDPARVTQTV |
| Ga0316610_1041841 | Ga0316610_10418414 | F064355 | MSTKNKFSIFNSKFFKYLKQLFTNEYPDSKPDVEKRKVAVENNLRWQDDGGPVVENTRPIVQAAENDPTKPGDVTGNDPDKRR |
| Ga0316610_1050843 | Ga0316610_10508431 | F084884 | LARFQAFFYALSFFQLDGVPPPAPARVTQTVRQIFGEIDL |
| Ga0316610_1050848 | Ga0316610_10508481 | F044511 | LKAKSKPTKRAPDAGDSGAIPSIFLRLSLFPVGRRPAARPSAGNANRWV |
| Ga0316610_1053080 | Ga0316610_10530801 | F057919 | MHEIFSLFGFFTFLTIAIQLLSGTMLSFSLVPEPMLIPLIREEEDLEDLYTDDFF |
| Ga0316610_1060710 | Ga0316610_10607101 | F045770 | MADLTANAPIRILGQEFTEEFTLDNSAAQTVYKGQPMIIDQSEDTVYLRGFVGATVVDPADIFCGIAAEGAISVATTDTETANKCKLWVFPTIVGFKSTVFTDADLGDTVYMSDSATISATAADNPMLGKLHRVLDGYAYVQISSPTICAGA |
| Ga0316610_1061874 | Ga0316610_10618743 | F044511 | GCLTKRAPDAGDSGAIPSIFLRLSIFPVGRRPAARPSAGNANRWAVGK |
| Ga0316610_1063330 | Ga0316610_10633303 | F002525 | VWVGVDNVWEQEKPEARKMLVNRAESHTSGARFVGWLCARLAD |
| Ga0316610_1068303 | Ga0316610_10683031 | F080961 | MQLNKLILSKRKQVMKKKYTQVIEQIITYSPLAGIVGASLLNLTKFQNQLLMLFLLIWASAFFLYKSWAT |
| Ga0316610_1074995 | Ga0316610_10749951 | F084884 | TLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVSP |
| Ga0316610_1075252 | Ga0316610_10752523 | F084884 | VHPTLGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLA |
| Ga0316610_1076697 | Ga0316610_10766972 | F044511 | LTLPPDAGDSGAIPSLFLRLILFPVGRRPAARPSAGNANR |
| Ga0316610_1084553 | Ga0316610_10845532 | F036727 | MEVCPDFVLEGLREKKKWFLRAQVIDNATYRRGMAVSSYNQGRSLSELTPKTWTHGTKRFMRPDSYWA |
| Ga0316610_1093212 | Ga0316610_10932121 | F002525 | VWEQEKLEARKMLENAAESHTSGARFVGRLFTRRLLCD |
| Ga0316610_1094407 | Ga0316610_10944071 | F044511 | RAPDAGDSGAIPSIFPRLSIFPVGRRSAARPSAGNANRWADTL |
| Ga0316610_1097986 | Ga0316610_10979861 | F081921 | MNTLPQSEQKEIYLQERAGETITDDSLPAAQVIEDQKNNAEQNNTPR |
| Ga0316610_1104596 | Ga0316610_11045961 | F002525 | VWAGVDSAWEQEKLEARKMLENAAESHTSGARFVGRRFASE |
| Ga0316610_1111161 | Ga0316610_11111611 | F091749 | IKSDNKSNAQSWELEVTCKNKEYLNKVIKTILKHGMINFEVEIVDYLHGKYTVFMWSSWFNNLATISKDLAKIEKLLDK |
| Ga0316610_1112320 | Ga0316610_11123201 | F000237 | LYLIQLHVLFCHESXDSDSGEATYEDKSGSYISXFYDAFLKEIQDAXYXTMFVFMYFXLHHFNPSTVNYFFFERXNISELDEIRFYGVAPHXYFRPLMGLLVISPTHYEGLMXMGLFFVLLAFLPIFYNXYNVYNKHIPTIPMQNSLIQTFAFIVFMLSMFCSASMLPCGRYYYEPEGGYVGNPXVKFSYQYIYLYLAXF |
| Ga0316610_1114906 | Ga0316610_11149061 | F084884 | LARFQAFFYALAFFQSDGVPPPDPARVTQTVSPPLAKGGIK |
| ⦗Top⦘ |