NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028737

3300028737: Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_100_MG



Overview

Basic Information
IMG/M Taxon OID3300028737 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127566 | Gp0272222 | Ga0233419
Sample NameFreshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_100_MG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyRestricted

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Dataset Contents
Total Genome Size454035341
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMethane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationIndonesia: South Sulawesi
CoordinatesLat. (o)-2.4667Long. (o)121.2833Alt. (m)N/ADepth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002525Metagenome / Metatranscriptome552Y
F006504Metagenome371N
F019160Metagenome231Y
F045455Metagenome / Metatranscriptome153Y
F081864Metagenome114Y
F086602Metagenome / Metatranscriptome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0233419_10051991Not Available954Open in IMG/M
Ga0233419_10052056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi953Open in IMG/M
Ga0233419_10075169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium813Open in IMG/M
Ga0233419_10198537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium528Open in IMG/M
Ga0233419_10208316All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
Ga0233419_10209266Not Available516Open in IMG/M

Sequences

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold IDProtein IDFamilySequence
Ga0233419_10051991Ga0233419_100519911F086602LTQGLLALVTELLKHRGPQQRRLRLFFDKGGYQGAIFRALAAQPEVDFYTPAVRYVDNVAAWEALPATAFDPAAFIYAKDANRPADQQPTYRLADTEMTLNVREGKAHKVVDTVTLRAIVLHDPRGPKPAERWPMVLLTDDRISDARTLLNEYGDHWGQEFAHRIGRHDLALDILPPGYVLTTTRDAQGALHRTVKDDQTAFFLTAWLRCLVFNLLTRFADALGGAHTKLWAGTLLRKFIRRPATLDLVGPELHVVFDPFPEQAALQPLLDRLNAKRTALPWLNNLVVQFRIAQDERVYPLTEPAKRKRLFGPG
Ga0233419_10052056Ga0233419_100520562F002525VWAGVDSAWEQEKPEARKMPENAAESHTSGARFVSP
Ga0233419_10075169Ga0233419_100751691F081864MEADTRQYLARNNRQPRGFGRWGFLVGNETFFFVGQYSNSRKEAFKVAQAQGEEWVVVLPEKKLAPQGGNPERPENMTQNQINSIKNRLMAQAETRTINKRTRTVIPVKGMKAAEVMMVFDIQSKRTAHAIVKRGYHIVDYMEARQCPGTMEDAEEAYRVAKWWFYKKLGGQAPHGLDADDMIQEAVTRLVELAGDPRMQEDSYKFYVVRSTMAEYLRRNQKHEHLDEEEIEAPGSRRGVWLRQREP
Ga0233419_10198537Ga0233419_101985371F045455SRVGDSSCQELNRSVWERAWQLLSPTLEVVAVYYRQRFCLLTLAEYGRILLEVAEPVRGKLRDRLRQIERQQYSLLENARPP
Ga0233419_10208316Ga0233419_102083162F019160MRVYLYYENVERPLAVEIPDNELEGFLREYEEALHDTSVESFQWKNSSFRIGGLLAIVQQRHASLS
Ga0233419_10209266Ga0233419_102092662F006504MPRTLKWGQTYTVMLDVGAVADAFILDSSTLDGTDTLDGSTDFYDATEYVLDVAIQRGRQNQTTQFSPGTVRLTFDDRASGRLFDPTNSASELYAGDFDLAPGRQVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.