| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028737 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127566 | Gp0272222 | Ga0233419 |
| Sample Name | Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_100_MG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Restricted |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Dataset Contents | |
|---|---|
| Total Genome Size | 454035341 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 6 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Indonesia: South Sulawesi | |||||||
| Coordinates | Lat. (o) | -2.4667 | Long. (o) | 121.2833 | Alt. (m) | N/A | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002525 | Metagenome / Metatranscriptome | 552 | Y |
| F006504 | Metagenome | 371 | N |
| F019160 | Metagenome | 231 | Y |
| F045455 | Metagenome / Metatranscriptome | 153 | Y |
| F081864 | Metagenome | 114 | Y |
| F086602 | Metagenome / Metatranscriptome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0233419_10051991 | Not Available | 954 | Open in IMG/M |
| Ga0233419_10052056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 953 | Open in IMG/M |
| Ga0233419_10075169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 813 | Open in IMG/M |
| Ga0233419_10198537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 528 | Open in IMG/M |
| Ga0233419_10208316 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| Ga0233419_10209266 | Not Available | 516 | Open in IMG/M |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0233419_10051991 | Ga0233419_100519911 | F086602 | LTQGLLALVTELLKHRGPQQRRLRLFFDKGGYQGAIFRALAAQPEVDFYTPAVRYVDNVAAWEALPATAFDPAAFIYAKDANRPADQQPTYRLADTEMTLNVREGKAHKVVDTVTLRAIVLHDPRGPKPAERWPMVLLTDDRISDARTLLNEYGDHWGQEFAHRIGRHDLALDILPPGYVLTTTRDAQGALHRTVKDDQTAFFLTAWLRCLVFNLLTRFADALGGAHTKLWAGTLLRKFIRRPATLDLVGPELHVVFDPFPEQAALQPLLDRLNAKRTALPWLNNLVVQFRIAQDERVYPLTEPAKRKRLFGPG |
| Ga0233419_10052056 | Ga0233419_100520562 | F002525 | VWAGVDSAWEQEKPEARKMPENAAESHTSGARFVSP |
| Ga0233419_10075169 | Ga0233419_100751691 | F081864 | MEADTRQYLARNNRQPRGFGRWGFLVGNETFFFVGQYSNSRKEAFKVAQAQGEEWVVVLPEKKLAPQGGNPERPENMTQNQINSIKNRLMAQAETRTINKRTRTVIPVKGMKAAEVMMVFDIQSKRTAHAIVKRGYHIVDYMEARQCPGTMEDAEEAYRVAKWWFYKKLGGQAPHGLDADDMIQEAVTRLVELAGDPRMQEDSYKFYVVRSTMAEYLRRNQKHEHLDEEEIEAPGSRRGVWLRQREP |
| Ga0233419_10198537 | Ga0233419_101985371 | F045455 | SRVGDSSCQELNRSVWERAWQLLSPTLEVVAVYYRQRFCLLTLAEYGRILLEVAEPVRGKLRDRLRQIERQQYSLLENARPP |
| Ga0233419_10208316 | Ga0233419_102083162 | F019160 | MRVYLYYENVERPLAVEIPDNELEGFLREYEEALHDTSVESFQWKNSSFRIGGLLAIVQQRHASLS |
| Ga0233419_10209266 | Ga0233419_102092662 | F006504 | MPRTLKWGQTYTVMLDVGAVADAFILDSSTLDGTDTLDGSTDFYDATEYVLDVAIQRGRQNQTTQFSPGTVRLTFDDRASGRLFDPTNSASELYAGDFDLAPGRQVK |
| ⦗Top⦘ |