Basic Information | |
---|---|
IMG/M Taxon OID | 3300025107 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0055717 | Ga0208863 |
Sample Name | Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D3 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 339959766 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 2 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Rifle, Colorado, Usa |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → land → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Rifle, Colorado, United States | |||||||
Coordinates | Lat. (o) | 39.534762 | Long. (o) | -107.782602 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002525 | Metagenome / Metatranscriptome | 552 | Y |
F038735 | Metagenome / Metatranscriptome | 165 | Y |
F050966 | Metagenome / Metatranscriptome | 144 | Y |
F096552 | Metagenome / Metatranscriptome | 104 | Y |
F105436 | Metagenome | 100 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208863_1002558 | All Organisms → cellular organisms → Bacteria | 9289 | Open in IMG/M |
Ga0208863_1020900 | Not Available | 2021 | Open in IMG/M |
Ga0208863_1047362 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
Ga0208863_1074079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii | 926 | Open in IMG/M |
Ga0208863_1149443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 570 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208863_1002558 | Ga0208863_10025581 | F105436 | MKLVFVNVMQELRRFDSTAYITQPPVPLAILNGATPKEIETALLDEQADRLRFEGDAFAFSVSTQNARAVYEHADALRASGGDARERPCATLFPGGL |
Ga0208863_1020900 | Ga0208863_10209002 | F050966 | MSGSMWQGMKTRHGDGTEALSEEMESNGSATPKSRRHPLTLPAD |
Ga0208863_1047362 | Ga0208863_10473622 | F038735 | MKRILNSMLGFWLLLLGISLGTAGIIYEVWLKGRI |
Ga0208863_1074079 | Ga0208863_10740793 | F002525 | VTCVWAGVDSVWEQEKLEARKMLVNRADSHTSVARFVGWRFSF |
Ga0208863_1149443 | Ga0208863_11494431 | F096552 | MKMKNVFAVTSTSLVLLLLAACNAIKPTPAPTQTPQVLPASGEQYYFVTNKLLLPTTQAQTEAYALNVDGDSQQRPDNKFGDLFTLLASAAQGIELQASLDQAVNTGQLVSLHVVKADGLLNDPSVLWSIFAGQKSQSAPRFDGSDNLTVDTAAPAYSPLVGLLTNGRFT |
⦗Top⦘ |