3300009311: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate b

Overview

Basic Information

• IMG/M Taxon OID: 3300009311
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118094 | Gp0127951 | Ga0117906
• Sample Name: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate b
• Sequencing Status: Permanent Draft
• Sequencing Center: Georgia Genomics Facility
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 405757630
• Sequencing Scaffolds: 4
• Novel Protein Genes: 4
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → coastal water body → coastal sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Alt. (m): N/A
  • Depth (m): 900

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002525	Metagenome / Metatranscriptome	552	Y
F036104	Metagenome / Metatranscriptome	170	Y
F087249	Metagenome / Metatranscriptome	110	Y
F092080	Metagenome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0117906_1009630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6537
Ga0117906_1047107	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1829
Ga0117906_1074887	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1275
Ga0117906_1105062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	978

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0117906_1009630	Ga0117906_10096304	F087249	MDAYIAAASENVDPSNIGTIDELSAKFLDTLSPKEMGFLMYDNPQPLSLQEVDREIRNKYKAKYGTKKLKRGQFFRLKSGTITFLPTNII*
Ga0117906_1047107	Ga0117906_10471073	F002525	MLWEQEKLEAKKILENGAESHTSGARFVSPLLNLSNS*
Ga0117906_1074887	Ga0117906_10748872	F092080	MPWKGGKKMQDKRVTIRVPFEIWKALRELQTVGKISSIQQAAVTGMDRLIVSLQNDAKDKKREAAKKRVLDVLVKGKPLGNWEDIHSERTAADVGRS
Ga0117906_1105062	Ga0117906_11050623	F036104	MGQEGIPLSIGLIIGAAILGAALVAGLVIMAVVGAFS*