 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029890 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133313 | Gp0288074 | Ga0246099 |
| Sample Name | Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2157 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Berkeley |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 123290341 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Atribacterota → Atribacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → planetary subsurface zone → groundwater |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Japan: Horonobe URL | |||||||
| Coordinates | Lat. (o) | 45.045278 | Long. (o) | 141.859444 | Alt. (m) | N/A | Depth (m) | 140 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002525 | Metagenome / Metatranscriptome | 552 | Y |
| F025315 | Metagenome | 202 | Y |
| F026446 | Metagenome / Metatranscriptome | 198 | Y |
| F044411 | Metagenome / Metatranscriptome | 154 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0246099_100005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 515733 | Open in IMG/M |
| Ga0246099_100019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 352688 | Open in IMG/M |
| Ga0246099_100525 | All Organisms → cellular organisms → Bacteria → Atribacterota → Atribacteria | 26138 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0246099_100004 | Ga0246099_100004405 | F002525 | VWAGVDNVWKQEKLEARKMLENAAESHTSGARFVGWLLALRLILGYIKT |
| Ga0246099_100005 | Ga0246099_100005105 | F044411 | MQTSPGFNQVYPGQAIAICSRAQAAQLVDYDHHTVRIQGRLGVLLTYPWLPLDENPGPFVLTVVFHHAEKHPAAPEAVQTLVDGLKFQFRGQAR |
| Ga0246099_100019 | Ga0246099_100019281 | F025315 | MQSYLLVTIEILIIVVMPLLVLYLKGSWPMREVVPSLVIIAVFWYFSYMIFHELSHAAGLYLVGGETLDYRLIPRFWLGEFGGGAAWITPSGIPMRWQQLTFHAFPYLVDVICLIVAVPIFKRSLLRNAFFAGLTFMLLCLRPAFNIVGEVIGLLTGWKGDLYNIQQIVGPFALWLFILIAVGLAVYSITVNLIHLIHSSKNVQRAANKIKHEIS |
| Ga0246099_100525 | Ga0246099_10052513 | F026446 | MKVTGETFSLLKKKKRRRGKILKISKLSGKRTVTGQNSGELL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |