| Basic Information | |
|---|---|
| Family ID | F025775 |
| Family Type | Metagenome |
| Number of Sequences | 200 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKQLLTFQGFPMVVVVGLIVWSWISILSVLIASFF |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.00 % |
| % of genes near scaffold ends (potentially truncated) | 15.00 % |
| % of genes from short scaffolds (< 2000 bps) | 62.50 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (30.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) (34.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF04545 | Sigma70_r4 | 34.00 |
| PF03597 | FixS | 25.00 |
| PF05751 | FixH | 11.50 |
| PF13746 | Fer4_18 | 4.50 |
| PF02687 | FtsX | 2.50 |
| PF00873 | ACR_tran | 2.00 |
| PF00005 | ABC_tran | 2.00 |
| PF14715 | FixP_N | 1.50 |
| PF00448 | SRP54 | 1.50 |
| PF00115 | COX1 | 1.00 |
| PF02881 | SRP54_N | 1.00 |
| PF13084 | DUF3943 | 1.00 |
| PF02433 | FixO | 1.00 |
| PF11614 | FixG_C | 0.50 |
| PF13492 | GAF_3 | 0.50 |
| PF13404 | HTH_AsnC-type | 0.50 |
| PF03602 | Cons_hypoth95 | 0.50 |
| PF13751 | DDE_Tnp_1_6 | 0.50 |
| PF13692 | Glyco_trans_1_4 | 0.50 |
| PF03916 | NrfD | 0.50 |
| PF01467 | CTP_transf_like | 0.50 |
| PF01887 | SAM_HAT_N | 0.50 |
| PF14559 | TPR_19 | 0.50 |
| PF02566 | OsmC | 0.50 |
| PF06831 | H2TH | 0.50 |
| PF05545 | FixQ | 0.50 |
| PF00486 | Trans_reg_C | 0.50 |
| PF13286 | HD_assoc | 0.50 |
| PF14693 | Ribosomal_TL5_C | 0.50 |
| PF13115 | YtkA | 0.50 |
| PF00023 | Ank | 0.50 |
| PF14572 | Pribosyl_synth | 0.50 |
| PF00550 | PP-binding | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG3197 | Cytochrome oxidase maturation protein, CcoS/FixS family | Posttranslational modification, protein turnover, chaperones [O] | 25.00 |
| COG5456 | Nitrogen fixation protein FixH | Inorganic ion transport and metabolism [P] | 11.50 |
| COG2993 | Cbb3-type cytochrome oxidase, cytochrome c subunit FixO | Energy production and conversion [C] | 1.00 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.50 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.50 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.50 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.50 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.50 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG4736 | Cbb3-type cytochrome oxidase, subunit 3 | Energy production and conversion [C] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078019|MiccSRB_F31IBB102F8RSO | Not Available | 537 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10010503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3013 | Open in IMG/M |
| 3300000185|Draft_c100124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 7717 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10003630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 7837 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10014278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3639 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10124047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 727 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10153196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 614 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10153542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 613 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10136385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 844 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1108179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 532 | Open in IMG/M |
| 3300000558|Draft_10123248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3731 | Open in IMG/M |
| 3300000558|Draft_10367954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300000558|Draft_10375337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2934 | Open in IMG/M |
| 3300000558|Draft_11688405 | Not Available | 646 | Open in IMG/M |
| 3300001592|Draft_10212875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 749 | Open in IMG/M |
| 3300001592|Draft_10360169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 525 | Open in IMG/M |
| 3300001605|Draft_10002874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 21086 | Open in IMG/M |
| 3300001605|Draft_10023387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 5775 | Open in IMG/M |
| 3300001813|JGI24123J20310_1000188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 47029 | Open in IMG/M |
| 3300003408|JGI26524J50256_1003382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica | 7692 | Open in IMG/M |
| 3300003418|JGI26523J50269_1076542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 509 | Open in IMG/M |
| 3300004066|Ga0055484_10225592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 518 | Open in IMG/M |
| 3300004072|Ga0055512_10117843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 557 | Open in IMG/M |
| 3300004282|Ga0066599_100145465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1209 | Open in IMG/M |
| 3300005643|Ga0079369_1014793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4235 | Open in IMG/M |
| 3300005643|Ga0079369_1015908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 4128 | Open in IMG/M |
| 3300005643|Ga0079369_1027440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 3344 | Open in IMG/M |
| 3300005643|Ga0079369_1035643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2984 | Open in IMG/M |
| 3300005643|Ga0079369_1063271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2258 | Open in IMG/M |
| 3300005643|Ga0079369_1112496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1608 | Open in IMG/M |
| 3300005643|Ga0079369_1267366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 631 | Open in IMG/M |
| 3300005794|Ga0079490_100087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 4282 | Open in IMG/M |
| 3300005892|Ga0075275_1011198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1216 | Open in IMG/M |
| 3300006224|Ga0079037_100011513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 5798 | Open in IMG/M |
| 3300006224|Ga0079037_100041774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3506 | Open in IMG/M |
| 3300006224|Ga0079037_100066259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 2901 | Open in IMG/M |
| 3300006224|Ga0079037_100515050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1150 | Open in IMG/M |
| 3300006224|Ga0079037_101091413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 792 | Open in IMG/M |
| 3300006417|Ga0069787_10436200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4658 | Open in IMG/M |
| 3300006417|Ga0069787_11444188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1068 | Open in IMG/M |
| 3300007281|Ga0104349_1087169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1483 | Open in IMG/M |
| 3300009009|Ga0105105_10016958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3008 | Open in IMG/M |
| 3300009009|Ga0105105_10090683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 1459 | Open in IMG/M |
| 3300009009|Ga0105105_10382785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 780 | Open in IMG/M |
| 3300009037|Ga0105093_10014655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3229 | Open in IMG/M |
| 3300009037|Ga0105093_10846198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 534 | Open in IMG/M |
| 3300009053|Ga0105095_10106108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1525 | Open in IMG/M |
| 3300009053|Ga0105095_10252730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 967 | Open in IMG/M |
| 3300009053|Ga0105095_10303413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 878 | Open in IMG/M |
| 3300009053|Ga0105095_10320492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 853 | Open in IMG/M |
| 3300009053|Ga0105095_10337710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 829 | Open in IMG/M |
| 3300009053|Ga0105095_10719913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 557 | Open in IMG/M |
| 3300009053|Ga0105095_10809254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 525 | Open in IMG/M |
| 3300009070|Ga0066256_1000626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 78548 | Open in IMG/M |
| 3300009075|Ga0105090_10034449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3155 | Open in IMG/M |
| 3300009075|Ga0105090_10040748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2902 | Open in IMG/M |
| 3300009075|Ga0105090_10416393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 819 | Open in IMG/M |
| 3300009075|Ga0105090_10953812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 523 | Open in IMG/M |
| 3300009078|Ga0105106_10706677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 720 | Open in IMG/M |
| 3300009078|Ga0105106_10749759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 696 | Open in IMG/M |
| 3300009078|Ga0105106_11307644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 514 | Open in IMG/M |
| 3300009081|Ga0105098_10337286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 733 | Open in IMG/M |
| 3300009081|Ga0105098_10686322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 542 | Open in IMG/M |
| 3300009082|Ga0105099_10450783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 774 | Open in IMG/M |
| 3300009082|Ga0105099_10659429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 646 | Open in IMG/M |
| 3300009082|Ga0105099_11008017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 530 | Open in IMG/M |
| 3300009085|Ga0105103_10529615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 664 | Open in IMG/M |
| 3300009087|Ga0105107_10139469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1706 | Open in IMG/M |
| 3300009087|Ga0105107_10221658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1323 | Open in IMG/M |
| 3300009087|Ga0105107_10234289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 1283 | Open in IMG/M |
| 3300009087|Ga0105107_10400616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 957 | Open in IMG/M |
| 3300009087|Ga0105107_10595658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 770 | Open in IMG/M |
| 3300009111|Ga0115026_10728477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 768 | Open in IMG/M |
| 3300009131|Ga0115027_10246899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1169 | Open in IMG/M |
| 3300009146|Ga0105091_10007165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4719 | Open in IMG/M |
| 3300009153|Ga0105094_10269807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 978 | Open in IMG/M |
| 3300009153|Ga0105094_10630767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 626 | Open in IMG/M |
| 3300009153|Ga0105094_10657010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 613 | Open in IMG/M |
| 3300009153|Ga0105094_10816433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 549 | Open in IMG/M |
| 3300009153|Ga0105094_10902350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 522 | Open in IMG/M |
| 3300009166|Ga0105100_10008861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 5833 | Open in IMG/M |
| 3300009166|Ga0105100_10012016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 5012 | Open in IMG/M |
| 3300009166|Ga0105100_10660222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 643 | Open in IMG/M |
| 3300009166|Ga0105100_11030646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 517 | Open in IMG/M |
| 3300009169|Ga0105097_10674904 | Not Available | 584 | Open in IMG/M |
| 3300009169|Ga0105097_10737212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 559 | Open in IMG/M |
| 3300009170|Ga0105096_10268669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 868 | Open in IMG/M |
| 3300009171|Ga0105101_10535807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 577 | Open in IMG/M |
| 3300009179|Ga0115028_11372761 | Not Available | 592 | Open in IMG/M |
| 3300009416|Ga0124846_1001743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 7340 | Open in IMG/M |
| 3300009416|Ga0124846_1207735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 806 | Open in IMG/M |
| 3300009506|Ga0118657_10004973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 21741 | Open in IMG/M |
| 3300009506|Ga0118657_10029428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 11321 | Open in IMG/M |
| 3300009693|Ga0116141_10111013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 1623 | Open in IMG/M |
| 3300009695|Ga0123337_10013318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 6956 | Open in IMG/M |
| 3300010356|Ga0116237_10277159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1535 | Open in IMG/M |
| 3300011007|Ga0139299_1164989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2175 | Open in IMG/M |
| 3300011264|Ga0151623_1065299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 12199 | Open in IMG/M |
| 3300011340|Ga0151652_10551474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 584 | Open in IMG/M |
| 3300012668|Ga0157216_10034353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2580 | Open in IMG/M |
| 3300012981|Ga0168316_102893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4366 | Open in IMG/M |
| 3300013092|Ga0163199_1000066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 66125 | Open in IMG/M |
| 3300014205|Ga0172380_10331434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1153 | Open in IMG/M |
| 3300014205|Ga0172380_11314244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 504 | Open in IMG/M |
| 3300014270|Ga0075325_1079717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 743 | Open in IMG/M |
| 3300014300|Ga0075321_1047227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 755 | Open in IMG/M |
| 3300014322|Ga0075355_1017683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1417 | Open in IMG/M |
| 3300014323|Ga0075356_1078129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 764 | Open in IMG/M |
| 3300014323|Ga0075356_1175134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 565 | Open in IMG/M |
| 3300014814|Ga0119849_1014733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1828 | Open in IMG/M |
| 3300014830|Ga0119906_1145724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 680 | Open in IMG/M |
| 3300015208|Ga0167664_1025924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2035 | Open in IMG/M |
| 3300015370|Ga0180009_10045803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2822 | Open in IMG/M |
| 3300015370|Ga0180009_10093763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 1605 | Open in IMG/M |
| 3300015370|Ga0180009_10439305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 511 | Open in IMG/M |
| 3300018055|Ga0184616_10026536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1816 | Open in IMG/M |
| 3300019775|Ga0197853_1011526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 104739 | Open in IMG/M |
| 3300019775|Ga0197853_1014544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 164985 | Open in IMG/M |
| 3300019775|Ga0197853_1021850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 8360 | Open in IMG/M |
| 3300019775|Ga0197853_1043694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 120258 | Open in IMG/M |
| 3300022181|Ga0228535_1000633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 87537 | Open in IMG/M |
| 3300022553|Ga0212124_10000038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 112289 | Open in IMG/M |
| 3300024056|Ga0124853_1139821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 715 | Open in IMG/M |
| 3300024973|Ga0209959_100011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 659158 | Open in IMG/M |
| 3300024973|Ga0209959_100036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 329946 | Open in IMG/M |
| 3300024973|Ga0209959_100058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 259641 | Open in IMG/M |
| 3300024978|Ga0209941_1047645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 972 | Open in IMG/M |
| 3300024988|Ga0209958_1002413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 10545 | Open in IMG/M |
| 3300025000|Ga0209318_1002642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 8519 | Open in IMG/M |
| 3300025153|Ga0209512_1099818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300025525|Ga0208244_100153 | Not Available | 86916 | Open in IMG/M |
| 3300025525|Ga0208244_100301 | All Organisms → cellular organisms → Bacteria | 54810 | Open in IMG/M |
| 3300025525|Ga0208244_105096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3312 | Open in IMG/M |
| 3300025856|Ga0209604_1194594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 811 | Open in IMG/M |
| 3300025963|Ga0210146_1002165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1833 | Open in IMG/M |
| 3300026019|Ga0208528_1017182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 682 | Open in IMG/M |
| 3300026349|Ga0256811_1008044 | Not Available | 939 | Open in IMG/M |
| 3300026463|Ga0256815_1015255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 804 | Open in IMG/M |
| 3300027282|Ga0209346_1024916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 986 | Open in IMG/M |
| 3300027283|Ga0209643_1000039 | All Organisms → cellular organisms → Bacteria | 381070 | Open in IMG/M |
| 3300027675|Ga0209077_1001555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 6289 | Open in IMG/M |
| 3300027675|Ga0209077_1003410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4201 | Open in IMG/M |
| 3300027713|Ga0209286_1022253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2331 | Open in IMG/M |
| 3300027713|Ga0209286_1041437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300027713|Ga0209286_1233369 | Not Available | 655 | Open in IMG/M |
| 3300027721|Ga0209492_1106461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 986 | Open in IMG/M |
| 3300027723|Ga0209703_1043879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1741 | Open in IMG/M |
| 3300027723|Ga0209703_1166156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 824 | Open in IMG/M |
| 3300027726|Ga0209285_10099012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus | 888 | Open in IMG/M |
| 3300027726|Ga0209285_10232542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 578 | Open in IMG/M |
| 3300027739|Ga0209575_10116404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300027740|Ga0214474_1025035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 2331 | Open in IMG/M |
| 3300027792|Ga0209287_10194766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 772 | Open in IMG/M |
| 3300027818|Ga0209706_10005575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 6611 | Open in IMG/M |
| 3300027818|Ga0209706_10130137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1244 | Open in IMG/M |
| 3300027818|Ga0209706_10191480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 995 | Open in IMG/M |
| 3300027818|Ga0209706_10479043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 571 | Open in IMG/M |
| 3300027841|Ga0209262_10166336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1061 | Open in IMG/M |
| 3300027871|Ga0209397_10023803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1970 | Open in IMG/M |
| 3300027871|Ga0209397_10180989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300027871|Ga0209397_10200658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 917 | Open in IMG/M |
| 3300027877|Ga0209293_10452455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300027885|Ga0209450_10794839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 683 | Open in IMG/M |
| 3300027887|Ga0208980_10003569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 9433 | Open in IMG/M |
| 3300027887|Ga0208980_10287468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 954 | Open in IMG/M |
| 3300027890|Ga0209496_10722570 | Not Available | 546 | Open in IMG/M |
| 3300027955|Ga0209078_1077936 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300027972|Ga0209079_10251233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus | 602 | Open in IMG/M |
| 3300028735|Ga0272446_1000842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 46809 | Open in IMG/M |
| 3300029892|Ga0246235_101953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 5207 | Open in IMG/M |
| 3300030613|Ga0299915_10039230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3534 | Open in IMG/M |
| 3300031578|Ga0307376_10000010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus | 382613 | Open in IMG/M |
| 3300032018|Ga0315272_10020734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2985 | Open in IMG/M |
| 3300032018|Ga0315272_10145692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1112 | Open in IMG/M |
| 3300032018|Ga0315272_10717813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 509 | Open in IMG/M |
| 3300032173|Ga0315268_10001853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 24309 | Open in IMG/M |
| 3300032256|Ga0315271_10000448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 22494 | Open in IMG/M |
| 3300032256|Ga0315271_10639432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 911 | Open in IMG/M |
| 3300033413|Ga0316603_10967265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 803 | Open in IMG/M |
| 3300033414|Ga0316619_10011490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3708 | Open in IMG/M |
| 3300033418|Ga0316625_100030241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 2348 | Open in IMG/M |
| 3300033433|Ga0326726_10019273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 5932 | Open in IMG/M |
| 3300033480|Ga0316620_10007953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 5507 | Open in IMG/M |
| 3300033480|Ga0316620_11285508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 719 | Open in IMG/M |
| 3300033482|Ga0316627_100020321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 3449 | Open in IMG/M |
| 3300033482|Ga0316627_100024367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 3240 | Open in IMG/M |
| 3300033485|Ga0316626_10359722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus | 1204 | Open in IMG/M |
| 3300033485|Ga0316626_11831525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 549 | Open in IMG/M |
| 3300033487|Ga0316630_10101499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1928 | Open in IMG/M |
| 3300033489|Ga0299912_10004650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 11254 | Open in IMG/M |
| 3300033513|Ga0316628_100134125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2863 | Open in IMG/M |
| 3300033513|Ga0316628_101584634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 872 | Open in IMG/M |
| 3300033513|Ga0316628_102711869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 652 | Open in IMG/M |
| 3300033513|Ga0316628_102804244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 640 | Open in IMG/M |
| 3300033521|Ga0316616_102001424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 767 | Open in IMG/M |
| 3300033521|Ga0316616_102143112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 743 | Open in IMG/M |
| 3300033521|Ga0316616_102467560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 697 | Open in IMG/M |
| 3300034052|Ga0373889_007903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1423 | Open in IMG/M |
| 3300034056|Ga0373893_016983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 870 | Open in IMG/M |
| 3300034169|Ga0370480_0162832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 761 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 30.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.50% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 8.50% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 4.50% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.00% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 3.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.50% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 2.00% |
| Enriched Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enriched Sediment | 2.00% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.50% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.50% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.50% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.00% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 1.00% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.00% |
| Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 1.00% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.50% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.50% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.50% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.50% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 0.50% |
| Basal Ice | Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice | 0.50% |
| Concrete Drainage Pipe Biofilm | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm | 0.50% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.50% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.50% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.50% |
| Fracture Fluid | Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid | 0.50% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface | 0.50% |
| Deep Surbsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface | 0.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.50% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.50% |
| Aeration Tank Of Activated Sludge Process | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process | 0.50% |
| Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.50% |
| Wastewater Bioreactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Wastewater Bioreactor | 0.50% |
| Defined Medium | Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078019 | Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383 | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000185 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300000311 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001592 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001813 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A | Environmental | Open in IMG/M |
| 3300003408 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan | Engineered | Open in IMG/M |
| 3300003418 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof | Engineered | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005643 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 3) | Engineered | Open in IMG/M |
| 3300005794 | Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
| 3300007281 | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B | Engineered | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009070 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2) | Engineered | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009416 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (PacBio error correction) | Engineered | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009695 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300011007 | Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB | Environmental | Open in IMG/M |
| 3300011264 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63 | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012981 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8 | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014814 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor | Engineered | Open in IMG/M |
| 3300014830 | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92511 | Engineered | Open in IMG/M |
| 3300015208 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface) | Environmental | Open in IMG/M |
| 3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300019775 | Lab enriched sediment microbial communities from hydrocarbon-contaminated retail site, Toronto, Canada - S1, HI.1247_001 | Engineered | Open in IMG/M |
| 3300022181 | Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1 | Engineered | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024973 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_300_biof (SPAdes) | Engineered | Open in IMG/M |
| 3300024978 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 (SPAdes) | Engineered | Open in IMG/M |
| 3300024988 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan (SPAdes) | Engineered | Open in IMG/M |
| 3300025000 | Soil microbial communities from Rifle, Colorado, USA - Groundwater E1 | Environmental | Open in IMG/M |
| 3300025153 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025525 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A (SPAdes) | Environmental | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025963 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026019 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 (SPAdes) | Environmental | Open in IMG/M |
| 3300026349 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6 | Environmental | Open in IMG/M |
| 3300026463 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6 | Environmental | Open in IMG/M |
| 3300027282 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/9 (SPAdes) | Environmental | Open in IMG/M |
| 3300027283 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes) | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028735 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-006-1 | Environmental | Open in IMG/M |
| 3300029892 | Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2011_MF | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034052 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2 | Engineered | Open in IMG/M |
| 3300034056 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3 | Engineered | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MiccSRB6591170 | 2044078019 | Concrete Drainage Pipe Biofilm | MKQLMTFQGFPMVLVVGLIVWAWISVLSVLVASFF |
| BS_KBA_SWE12_21mDRAFT_100105035 | 3300000124 | Marine | MKQLLTFQGFPMVVVVAMIAWAWISLISVLIASFF* |
| Draft_1001249 | 3300000185 | Hydrocarbon Resource Environments | MKQLLTFQGFPMVVVVGMIVWSWISVLSVLIASFF* |
| TB_PC08_66DRAFT_100036301 | 3300000228 | Groundwater | MKQLLTFQGFPMVVVVGLILWAWISILSVLIGSFF* |
| TB_PC08_66DRAFT_100142781 | 3300000228 | Groundwater | MKQLMTFQGFPMVLVVGLIVWAWVSVLSVLVASFF* |
| TB_PC08_66DRAFT_101240471 | 3300000228 | Groundwater | MKQLFTFQGFPMVLVVGLILWAWISLLSVLIGSFF* |
| TB_PC08_66DRAFT_101531961 | 3300000228 | Groundwater | MKQLMTFQNFPMVLVVGLIVWAWVSVLSVLVASFF* |
| TB_PC08_66DRAFT_101535422 | 3300000228 | Groundwater | MKQLLTFQGFPLVVVVGLIVWAWISILSVLIGSFF* |
| TB_LI09_4DRAFT_101363852 | 3300000231 | Groundwater | MKQLFTFQGFPMVVVVALIVWSWISIFSVLIAAFF* |
| WSSedA1Ba3DRAFT_11081791 | 3300000311 | Wetland | MKQLLTFQGFPMVVVVGLIVWAWISILSVLVGSFF* |
| Draft_101232483 | 3300000558 | Hydrocarbon Resource Environments | MKQLLTFQGFPMVVVVAFVVWSWFSILSVVIASFF* |
| Draft_103679542 | 3300000558 | Hydrocarbon Resource Environments | MKQLFTFQGFPMLVVVGMIAWSWFSILSVLVASLF* |
| Draft_103753374 | 3300000558 | Hydrocarbon Resource Environments | MKQLFTFQGFPMVVVVALIVWSWISVLSVLIASFF* |
| Draft_116884053 | 3300000558 | Hydrocarbon Resource Environments | MKQLLTFQGFPMVVVVAFVVWSWISILSVLIASFF* |
| Draft_102128751 | 3300001592 | Hydrocarbon Resource Environments | MNKLKFNDFNGVSEMKQLLTFQGFPMVIVTGMVIWSWISILSVVLASFF* |
| Draft_103601692 | 3300001592 | Hydrocarbon Resource Environments | MKQLLTFQGFPMVVVVALIVWSWISILSVVIGSLF* |
| Draft_100028745 | 3300001605 | Hydrocarbon Resource Environments | MKQLLTFQGFPMVVVVALIVWSWISILSVLVTSFF* |
| Draft_100233872 | 3300001605 | Hydrocarbon Resource Environments | MKQLLTFQSFPMVVVTAMIIWAWISVFSVLIAAFF* |
| JGI24123J20310_100018825 | 3300001813 | Serpentinite Rock And Fluid | MKQLFTFQGFPMVVVTAMIIWAWISVLSVLIASFF* |
| JGI26524J50256_10033821 | 3300003408 | Wastewater Bioreactor | NFNGARTMKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
| JGI26523J50269_10765421 | 3300003418 | Wastewater Bioreactor | MKQLLTFQSFPMVVVTGLIIWAWISILSVLIARSSDVARA |
| Ga0055484_102255921 | 3300004066 | Natural And Restored Wetlands | NFNGVRAMKQLLTFQGFPMVVVVAMVAWAWISLISVLIASFF* |
| Ga0055512_101178431 | 3300004072 | Natural And Restored Wetlands | NKLKFSNLNGVQAMKQLLTFQGFPMVVVVAMVAWAWISLLSVLVASFF* |
| Ga0066599_1001454653 | 3300004282 | Freshwater | LIGVRDMKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF* |
| Ga0079369_10147935 | 3300005643 | Wastewater Bioreactor | MKQFLTFQRFPMVVVVALIVWSWISILSVVIGSLF* |
| Ga0079369_10159085 | 3300005643 | Wastewater Bioreactor | MKQLLTFQSFPMVVVTGLIIWAWISILSVLIASFF* |
| Ga0079369_10274403 | 3300005643 | Wastewater Bioreactor | MKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF* |
| Ga0079369_10356434 | 3300005643 | Wastewater Bioreactor | MKQFLPFQGFPMVVVVALIVWSWISILSVVIGSLF* |
| Ga0079369_10632713 | 3300005643 | Wastewater Bioreactor | MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
| Ga0079369_11124964 | 3300005643 | Wastewater Bioreactor | MKQFLTFQGFPMVVVVALIVWSWISILSVVIGSLF* |
| Ga0079369_12673662 | 3300005643 | Wastewater Bioreactor | MKQFLTFQGFPMVVVVALIVWSWISILSMVIGSLF* |
| Ga0079490_1000873 | 3300005794 | Sediment | MKQFMSFQNFPMVVVTLMIIWAWISILSVLIASFF* |
| Ga0075275_10111982 | 3300005892 | Rice Paddy Soil | MKQLLTFQGFPMVVVVGLIVWAWISILSVLIGSFF* |
| Ga0079037_1000115138 | 3300006224 | Freshwater Wetlands | MKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF* |
| Ga0079037_1000417742 | 3300006224 | Freshwater Wetlands | MKQLLTFQNFPMVVVTGLILWAWFSILSVLIASFF* |
| Ga0079037_1000662594 | 3300006224 | Freshwater Wetlands | MKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF* |
| Ga0079037_1005150502 | 3300006224 | Freshwater Wetlands | FNKFYGVRAMKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF* |
| Ga0079037_1010914132 | 3300006224 | Freshwater Wetlands | MKQLLTFQGFPMVVVVGLVLWSWISILSVLIGSFF* |
| Ga0069787_104362005 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MKQLLTFQGFPMVVVVALIVWSWVSILSVVIGSLF* |
| Ga0069787_114441882 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MKQLLTFQGFPMVVVVGLIIWAWISILSVLIGSFF* |
| Ga0104349_10871693 | 3300007281 | Aeration Tank Of Activated Sludge Process | MKQLLTFQGFPMVVVTGLIIWSWISILSVLIGSFF* |
| Ga0105105_100169585 | 3300009009 | Freshwater Sediment | MNFNGVRAMKQLLTFQGFPMVVVVAMIAWAWISLISMLIASFF* |
| Ga0105105_100906833 | 3300009009 | Freshwater Sediment | MKQLLTFQGFPMVVVVGLVAWAWISILSVLIGSFF* |
| Ga0105105_103827852 | 3300009009 | Freshwater Sediment | MKQLLTFQGFPMVVVVAMIVWSWISVLSVLIASFF* |
| Ga0105093_100146554 | 3300009037 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISIISVLVASFF* |
| Ga0105093_108461982 | 3300009037 | Freshwater Sediment | MKQLFTFQNFPMLLVVGLIAWAWISILSVLIASIF* |
| Ga0105095_101061082 | 3300009053 | Freshwater Sediment | MKQLLTFQGFPMVVVVGLIIWSWISVFSVLIGSFF* |
| Ga0105095_102527301 | 3300009053 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF* |
| Ga0105095_103034132 | 3300009053 | Freshwater Sediment | MKQLFTFQGFPMVVVVALVVWSWISILSVLIAAFF* |
| Ga0105095_103204923 | 3300009053 | Freshwater Sediment | MKQLLTFQGFPMVVVIGFVVWSWISLLSVLIASFF* |
| Ga0105095_103377102 | 3300009053 | Freshwater Sediment | MKQLLTFQGFPMVVVVALVLWSWFSIFSVVIASFF* |
| Ga0105095_107199131 | 3300009053 | Freshwater Sediment | MMKQLFTFQGFPMVVVVALIVWSWISIFSVLFASFF* |
| Ga0105095_108092542 | 3300009053 | Freshwater Sediment | MKQLLTFQGFPMVVVAALIIWSWISIFSVLVASFF* |
| Ga0066256_100062621 | 3300009070 | Wastewater Bioreactor | MKHLLTFQGFPMVVVIALIVWSWFSILSVIVAKLF* |
| Ga0105090_100344492 | 3300009075 | Freshwater Sediment | MKQLLTFQGLPMVIVTGMIIWSWISILSVLVASFF* |
| Ga0105090_100407484 | 3300009075 | Freshwater Sediment | MKQLLTFQGFPMVVVTALIIWAWISVLSVLIASFF* |
| Ga0105090_104163932 | 3300009075 | Freshwater Sediment | MKQLLTFQGFPMVVVAAMIIWSWISILSVLIASFF* |
| Ga0105090_109538121 | 3300009075 | Freshwater Sediment | MKQMMTFQNFPMVLVVGLIVWAWISVLSVLIASFF* |
| Ga0105106_107066772 | 3300009078 | Freshwater Sediment | MKQLFTFQNFPMLLVVGLIAWAWISILSVLVASIF* |
| Ga0105106_107497592 | 3300009078 | Freshwater Sediment | MKQLFTFQGFPMVVVTALIIWAWVSVISVLIASFF* |
| Ga0105106_113076443 | 3300009078 | Freshwater Sediment | MKQLFTFQNFPMVVVTGLILWAWISILSVLITSFF* |
| Ga0105098_103372861 | 3300009081 | Freshwater Sediment | MKQLLTFQGFPMVVVTAMIIWSWISILSVLIASFF* |
| Ga0105098_106863222 | 3300009081 | Freshwater Sediment | MKQLLTFQGFPMVVVVAMIVWAWISLISMLIASFF* |
| Ga0105099_104507832 | 3300009082 | Freshwater Sediment | MKQLLTFQGFPMVVVLAMIFWSWISVLSVLIASFF* |
| Ga0105099_106594292 | 3300009082 | Freshwater Sediment | MKQLLTFQGFPMVVVVAMVAWAWISLISVLIASFF* |
| Ga0105099_110080172 | 3300009082 | Freshwater Sediment | INGVRIMKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF* |
| Ga0105103_105296152 | 3300009085 | Freshwater Sediment | MKQLMTFQGFPMVLVVGLIVWAWISVLSVLVASFF* |
| Ga0105107_101394692 | 3300009087 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISVLSVLVASFF* |
| Ga0105107_102216581 | 3300009087 | Freshwater Sediment | MKQLLTFQSFPMVVVVGMIIWAWISILSVLVASFF* |
| Ga0105107_102342891 | 3300009087 | Freshwater Sediment | NFYGVRAMKQLLTFQGFPMVVVVGLIIWSWISVFSVLIGSFF* |
| Ga0105107_104006162 | 3300009087 | Freshwater Sediment | MKQLMTFQNFPMVLVVGLIAWAWISVLSVLIASFF* |
| Ga0105107_105956582 | 3300009087 | Freshwater Sediment | MKQLLTFQGFPMVVVVGLVIWSWISVFSVLVASFF* |
| Ga0115026_107284772 | 3300009111 | Wetland | MKQLMTFQGFPMVVVVGLIVWAWISILSVLVGSFF* |
| Ga0115027_102468993 | 3300009131 | Wetland | MKQLLTFQGFPMVVVVGLVIWSWISILSVLIASLF* |
| Ga0105091_100071652 | 3300009146 | Freshwater Sediment | MKQLMTFQGFPMVLVVGLIVWSWISVLSVLVASFF* |
| Ga0105094_102698073 | 3300009153 | Freshwater Sediment | MKQLLTFQGFPMVVVVAMIVWSWISVLSVLVASFF* |
| Ga0105094_106307672 | 3300009153 | Freshwater Sediment | MKQLFTFQGFPMLVVVALVVWSWISILSVLFASLF* |
| Ga0105094_106570101 | 3300009153 | Freshwater Sediment | RTNKLKFINFYGVRAMKQLLTFQGFPMVVVVGLIIWSWISVFSVLIGSFF* |
| Ga0105094_108164332 | 3300009153 | Freshwater Sediment | MKQLLTFQGFPMVVVVGFVVWSWISVLSVLIASFF* |
| Ga0105094_109023502 | 3300009153 | Freshwater Sediment | INFNGVRAMKQLLTFQGFPMVVVVAMIVWAWISLISMLIASFF* |
| Ga0105100_100088615 | 3300009166 | Freshwater Sediment | MNFNGVRAMKQLLTFQGFPMVVVVAMIAWAWISLISVLIASFF* |
| Ga0105100_100120164 | 3300009166 | Freshwater Sediment | MKQLFTFQGFPMVVVVAMIVWSWISVISVLIASFF* |
| Ga0105100_106602222 | 3300009166 | Freshwater Sediment | MKQLFTFQGFPMLVVVALVVWSWISIFSVLFASFF* |
| Ga0105100_110306462 | 3300009166 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISILSVLVASFL* |
| Ga0105097_106749043 | 3300009169 | Freshwater Sediment | MKQLLTFQGFPMVVVTGMIIWAWISILSVLVASFF* |
| Ga0105097_107372122 | 3300009169 | Freshwater Sediment | MKQLMTFQNFPMVLVVGLIAWAWISVLSVLVASFF* |
| Ga0105096_102686692 | 3300009170 | Freshwater Sediment | MKQLLTFQGFPMVVVTAMIIWSWISILSVLVASFF* |
| Ga0105101_105358071 | 3300009171 | Freshwater Sediment | RTNKLKFINFYGVRAMKQLLTFQGFPMVVVVGLVIWSWISVFSVLIASFF* |
| Ga0115028_113727612 | 3300009179 | Wetland | KFNKFYGVRAMKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF* |
| Ga0124846_10017433 | 3300009416 | Wastewater Bioreactor | MNQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
| Ga0124846_12077353 | 3300009416 | Wastewater Bioreactor | NFNGARTMKQLLTFQGFPMVVVTGWIVWAWISIFSVLIGSFF* |
| Ga0118657_1000497319 | 3300009506 | Mangrove Sediment | MKQLLTFQGFPMVVVVALIVWAWISILSVLIGSFF* |
| Ga0118657_100294286 | 3300009506 | Mangrove Sediment | MKQYLTFQGFPMVVVVALIVWAWISILSVLIGSFF* |
| Ga0116141_101110132 | 3300009693 | Anaerobic Digestor Sludge | MKQLLTFQGFPMVVVVGMIVWAWISILSVLIGSFF* |
| Ga0123337_100133184 | 3300009695 | Glacier Valley | MKQLMTFQNFPMVLVVALITWAWISVLSVLIASFF* |
| Ga0116237_102771594 | 3300010356 | Anaerobic Digestor Sludge | MEFSNMKQLLTFQGFPMVVVVGLIVWAWISILSVLIGSFF* |
| Ga0139299_11649891 | 3300011007 | Basal Ice | MKQFMTFQGFPMVVVTLMIIWAWISILSVLIGSFF* |
| Ga0151623_10652998 | 3300011264 | Sediment | MKQLLTFQGFPLVVVVGLIVWAWISLLSVLIGAFF* |
| Ga0151652_105514743 | 3300011340 | Wetland | MKQLMTFQGFPMVLVVGLIVWAWISVLSVLIASFF* |
| Ga0157216_100343534 | 3300012668 | Glacier Forefield Soil | VKKYMTFQNLPMVLVTLMIVGAWASIFSVLIASFF* |
| Ga0168316_1028934 | 3300012981 | Weathered Mine Tailings | MKQLMTFQSFPMVVVTGMIIWAWISILSVLVASFF* |
| Ga0163199_100006654 | 3300013092 | Freshwater | MNNLFTKYGFPMVVITALIVWAWISFISVLLGKLV* |
| Ga0172380_103314342 | 3300014205 | Landfill Leachate | MKQLFTFQGFPMVVVVALVVWSWISIFSVLIAAFF* |
| Ga0172380_113142442 | 3300014205 | Landfill Leachate | EFINFYGVRTMKQLFTFQGFPMVVVVALIVWSWISILSVLIAAFF* |
| Ga0075325_10797172 | 3300014270 | Natural And Restored Wetlands | MKQLLTFQGFPMVVVVALIVWAWASIISVLIGSFF* |
| Ga0075321_10472272 | 3300014300 | Natural And Restored Wetlands | MKQLLTFQGLPMVVVVGLIIWAWASILSVLIASFF* |
| Ga0075355_10176832 | 3300014322 | Natural And Restored Wetlands | MKQLLTFQGFPMVVVVAMVAWAWISLLSVLVASFF* |
| Ga0075356_10781292 | 3300014323 | Natural And Restored Wetlands | MKQLLTFQGFPMVLVVGMVIWAWISLLSVLVASFF* |
| Ga0075356_11751343 | 3300014323 | Natural And Restored Wetlands | MKQLLTFQGFPMVVVVVMVAWAWISLLSVLVASFF* |
| Ga0119849_10147331 | 3300014814 | Wastewater Bioreactor | ARTMKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF* |
| Ga0119906_11457241 | 3300014830 | Activated Sludge | KFTNFFGARTMKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
| Ga0167664_10259243 | 3300015208 | Glacier Forefield Soil | MKQFMTFQGFPMVVVTLMIIWAWVSILSVLIGSFF* |
| Ga0180009_100458034 | 3300015370 | Groundwater | MKQYLTFQGFPMVVVTLMIIWAWVSILSVLIGSFF* |
| Ga0180009_100937632 | 3300015370 | Groundwater | MKQLFTFQGFPMVVVTGLIIWAWVSLLSVLIASFF* |
| Ga0180009_104393052 | 3300015370 | Groundwater | LKSINFYGARTMKQLFTFQGFPMVVVTALIIWAWISVLSVLIASFF* |
| Ga0184616_100265363 | 3300018055 | Groundwater Sediment | MKQLFTFQNFPMVVVTGLIVWAWISVLSVLIASFF |
| Ga0197853_101152688 | 3300019775 | Enriched Sediment | MKRLLTFQGFPMVVVTALIVWAWISIFSVLIASFF |
| Ga0197853_1014544146 | 3300019775 | Enriched Sediment | MKQLLTFQGFPMVVVWILVAWAWFSIFSVLIGSLF |
| Ga0197853_10218505 | 3300019775 | Enriched Sediment | MKQLLTFQGFPMVVVVALIVWSWISILSVVIGSLF |
| Ga0197853_1043694120 | 3300019775 | Enriched Sediment | MKQLFTFQGFPMVVVVALIVWSWISILSVLIAAFF |
| Ga0228535_100063371 | 3300022181 | Defined Medium | MKQLLTFQGFPMVVVVGLIIWAWISILSVLIGSFF |
| Ga0212124_1000003895 | 3300022553 | Freshwater | MNNLFTKYGFPMVVITALIVWAWISFISVLLGKLV |
| Ga0124853_11398212 | 3300024056 | Freshwater Wetlands | MKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF |
| Ga0209959_10001192 | 3300024973 | Wastewater Bioreactor | MKQLLTFQSFPMVVVTGLIIWAWISILSVLIASFF |
| Ga0209959_100036115 | 3300024973 | Wastewater Bioreactor | MKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF |
| Ga0209959_100058106 | 3300024973 | Wastewater Bioreactor | MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF |
| Ga0209941_10476452 | 3300024978 | Wastewater Bioreactor | MKQFLTFQGFPMVVVVALIVWSWISILSVVIGSLF |
| Ga0209958_100241312 | 3300024988 | Wastewater Bioreactor | MKQFLTFQSFPMVVVVALIVWSWISILSVVIGSLF |
| Ga0209318_100264211 | 3300025000 | Soil | MKQLLTFQGFPMVVVVGLIVWSWISILSVLIASFF |
| Ga0209512_10998183 | 3300025153 | Glacier Valley | MKQLMTFQNFPMVLVVALITWAWISVLSVLIASFF |
| Ga0208244_10015330 | 3300025525 | Serpentinite Rock And Fluid | MKQLFTFQGFPMVVVTAMIIWAWISVLSVLIASFF |
| Ga0208244_10030129 | 3300025525 | Serpentinite Rock And Fluid | MKQLFTFQGFPMVVVVAMIVWSWISVISVLIASFF |
| Ga0208244_1050962 | 3300025525 | Serpentinite Rock And Fluid | MKQLLTFQSFPMVVVTAMIVWAWISILSVLIGSFF |
| Ga0209604_11945942 | 3300025856 | Anaerobic Digestor Sludge | MKQLLTFQGFPMVVVVGMIVWAWISILSVLIGSFF |
| Ga0210146_10021652 | 3300025963 | Natural And Restored Wetlands | MKQLLTFQGFPMVVVVAMIAWAWISLISVLIASFF |
| Ga0208528_10171822 | 3300026019 | Rice Paddy Soil | TNKLKLINFNGVRAMKQLLTFQGFPMVVVVGLIVWAWISILSVLIGSFF |
| Ga0256811_10080443 | 3300026349 | Sediment | MKQLLTFQGFPMVVVVAMVAWAWISLISVLIASFF |
| Ga0256815_10152551 | 3300026463 | Sediment | MKQLLTFQGFPMVVVVAMVAWAWISLLSVLVGSFF |
| Ga0209346_10249162 | 3300027282 | Deep Subsurface | MKQFMTFQSFPMVVVTLMVIWAWVSILSVLIGSFF |
| Ga0209643_100003981 | 3300027283 | Deep Surbsurface | MKQLFTFQGFPMVVVVALVVWSWISILSVLIAAFF |
| Ga0209077_10015558 | 3300027675 | Freshwater Sediment | MKQLLTFQGFPMVVVVAMIVWSWISVLSVLIASFF |
| Ga0209077_10034103 | 3300027675 | Freshwater Sediment | MKQLLTFQGFPMVVVTALIIWAWISVLSVLIASFF |
| Ga0209286_10222533 | 3300027713 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF |
| Ga0209286_10414373 | 3300027713 | Freshwater Sediment | MKQLFTFQGFPMVVVTGLIVWAWVSVISVLIASFF |
| Ga0209286_12333691 | 3300027713 | Freshwater Sediment | MKQLLTFQGFPMVVVTAMIIWAWISILSVLVASFF |
| Ga0209492_11064613 | 3300027721 | Freshwater Sediment | MKQLLTFQGFPMVVVAAMIIWSWISILSVLIASFF |
| Ga0209703_10438793 | 3300027723 | Freshwater Sediment | MKQLFTFQNFPMLLVVGLIAWAWISILSVLIASIF |
| Ga0209703_11661563 | 3300027723 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISILSVLVASFL |
| Ga0209285_100990123 | 3300027726 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISIISVLVASFF |
| Ga0209285_102325422 | 3300027726 | Freshwater Sediment | NGVRAMKQLLTFQGFPMVVVVALIVWSWISILSVLVASFL |
| Ga0209575_101164043 | 3300027739 | Freshwater | MKQLLTFQGFPMVVVVGLILWAWISILSVLIGSFF |
| Ga0214474_10250352 | 3300027740 | Soil | MKQLLTFQGFPMVVVVGLVIWSWISVFSVLIASFF |
| Ga0209287_101947661 | 3300027792 | Freshwater Sediment | VKTNKLKFINFYGVRAMKQLLTFQGFPMVVVTAMIIWAWISILSVLVASFF |
| Ga0209706_100055754 | 3300027818 | Freshwater Sediment | MKQLLTFQGFPMVVVVALIVWSWISVLSVLVASFF |
| Ga0209706_101301371 | 3300027818 | Freshwater Sediment | MKQLFTFQGFPMVVVTALIIGAWISVFSVLIASFF |
| Ga0209706_101914802 | 3300027818 | Freshwater Sediment | KTNKLKFINFNGVRTMKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF |
| Ga0209706_104790432 | 3300027818 | Freshwater Sediment | RTMKQLFTFQNFPMLLVVGLIAWAWISILSVLIASIF |
| Ga0209262_101663362 | 3300027841 | Freshwater | MKQLLTFQGFPMVVVVGLILWAWISILSVLIASFF |
| Ga0209397_100238034 | 3300027871 | Wetland | MKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF |
| Ga0209397_101809893 | 3300027871 | Wetland | MKQLLTFQNFPMVVVTGLILWAWFSILSVLIASFF |
| Ga0209397_102006583 | 3300027871 | Wetland | MKQLLTFQGFPMVVVVGLVLWSWISILSVLIGSFF |
| Ga0209293_104524551 | 3300027877 | Wetland | LIGVCDMKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF |
| Ga0209450_107948391 | 3300027885 | Freshwater Lake Sediment | AKTNKLKFINFNGVCAMKQLLTFQGFPMVVVVGLILWAWISILSVLIGSFF |
| Ga0208980_1000356911 | 3300027887 | Wetland | MKQLLTFQGFPMVVVVGLIVWAWISILSVLVGSFF |
| Ga0208980_102874683 | 3300027887 | Wetland | MKQLLTFQGFPMVVVVGLVLWSWISVLSVLIGSFF |
| Ga0209496_107225702 | 3300027890 | Wetland | FYGVRAMKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF |
| Ga0209078_10779363 | 3300027955 | Freshwater Sediment | MKQLFTFQGFPMVVVVAMIVWSWISVLSVLIASFF |
| Ga0209079_102512333 | 3300027972 | Freshwater Sediment | MKQLLTFQGFPMVVVTAMIIWAWISILSVLIASFF |
| Ga0272446_100084224 | 3300028735 | Microbial Mat | MKKFLTFQNFPMVLVVGLIVWAWISLLSVLAASLF |
| Ga0246235_1019534 | 3300029892 | Fracture Fluid | MKQFLTFQGFPMVVVTALIVWAWISILSVLIASFF |
| Ga0299915_100392303 | 3300030613 | Soil | MKQLLTFQGFPMVVVVGLVLWAWASILSVLVASFF |
| Ga0307376_1000001098 | 3300031578 | Soil | MKQLFTFQGFPMVVVVALIVWSWISIFSVLIAAFF |
| Ga0315272_100207343 | 3300032018 | Sediment | MKQYLTFQGAPMVLVIGLVLWAWISILSVLVGSFF |
| Ga0315272_101456921 | 3300032018 | Sediment | VKTNKLKFINFNGVCVMKQLLTFQGFPMVVVVGLIIWAWISILSVLVGSFF |
| Ga0315272_107178132 | 3300032018 | Sediment | HAMKQLLTFQGFPMVLVVGMIVWAWISLFSVLIAWLF |
| Ga0315268_1000185326 | 3300032173 | Sediment | MKQLLTFQGFPMVVVVGLIIWAWISILSVLVGSFF |
| Ga0315271_100004482 | 3300032256 | Sediment | MKQLLTFQGFPMVLVVGMIVWAWISLFSVLIAWLF |
| Ga0315271_106394322 | 3300032256 | Sediment | MKQLMTFQNFPMVLVVGLITWAWISIISVLIGSFF |
| Ga0316603_109672652 | 3300033413 | Soil | MKQLMTFQGFPMVLVVGLILWAWISVFSVLIASFF |
| Ga0316619_100114901 | 3300033414 | Soil | SLTLIGVCDMKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF |
| Ga0316625_1000302414 | 3300033418 | Soil | MKQLMTFQNFPMVLVIGLITWAWFSIISVLIGSFF |
| Ga0326726_100192733 | 3300033433 | Peat Soil | MKQLLTFQGFPMVVVVVMVAWAWISLLSVLVASFF |
| Ga0316620_100079533 | 3300033480 | Soil | MKQLLTFQGFPMVVVVGLIAWAWISILSVLIGSFF |
| Ga0316620_112855082 | 3300033480 | Soil | MKQLMTFQGFPMVVVVGLIVWAWISILSVLVGSFF |
| Ga0316627_1000203214 | 3300033482 | Soil | MKQLLTFQGFPMVVVVGLIAWAWISILSVLIASFF |
| Ga0316627_1000243674 | 3300033482 | Soil | MKQLLTFQGFPMVVVVAMIIWAWISILSVLIGSFF |
| Ga0316626_103597222 | 3300033485 | Soil | MMKQLFTFQGFPMVVVVALIVWSWISILSVLFASFF |
| Ga0316626_118315253 | 3300033485 | Soil | MKKFMTFQGFPMVVVTAMIIWAWISVLSVLVASFF |
| Ga0316630_101014993 | 3300033487 | Soil | MKQLMTFQNFPMVLVVGLIAWAWISVLSVLIASFF |
| Ga0299912_100046505 | 3300033489 | Soil | MKQLLTFQGFPMVVVVALVIWSWISLFSVLVASFF |
| Ga0316628_1001341253 | 3300033513 | Soil | MKQLLTFQGFPMVVVWGFIAWAWFSLLSVLIASLF |
| Ga0316628_1015846342 | 3300033513 | Soil | MKQLLTFQGFPMVVVVGLILWAWISIFSVLIGSFF |
| Ga0316628_1027118691 | 3300033513 | Soil | LKLVNLNGVRTMKQLLTFQGFPMVVVVGLIAWAWISILSVLIASFF |
| Ga0316628_1028042442 | 3300033513 | Soil | MKQLLTFQGFPMVVVWGFVAWAWFSLLSVLIASLF |
| Ga0316616_1020014242 | 3300033521 | Soil | MKQLMTFQGFPMVVVVGFIVWAWISILSVLIGSFF |
| Ga0316616_1021431121 | 3300033521 | Soil | TMKQLLTFQGFPMVVVVGLILWAWISIFSVLIGSFF |
| Ga0316616_1024675601 | 3300033521 | Soil | MKQLLTFQGFPMVVVIGFVVWSWISLLSVLIASFF |
| Ga0373889_007903_1073_1180 | 3300034052 | Sediment Slurry | MKQLLTFQGFPMVVVIGMVIWSWISIISVLVASFF |
| Ga0373893_016983_27_134 | 3300034056 | Sediment Slurry | MKQLLTFQGFPMVVVIGLVIWSWISILSVLVASFF |
| Ga0370480_0162832_594_701 | 3300034169 | Untreated Peat Soil | MKQLLTFQGFPMIVVVGMIIWAWISILSVLMGSFF |
| ⦗Top⦘ |