3300009416: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (PacBio error correction)

Overview

Basic Information

• IMG/M Taxon OID: 3300009416
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118793 | Gp0095089 | Ga0124846
• Sample Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (PacBio error correction)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 467716430
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Bioreactor Microbial Communities From Cape Town, South Africa
• Type: Engineered
• Taxonomy: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Cape Town, South Africa
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0124846_1001743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	7340
Ga0124846_1207735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	806

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0124846_1001743	Ga0124846_10017433	F025775	MNQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF*
Ga0124846_1207735	Ga0124846_12077353	F025775	NFNGARTMKQLLTFQGFPMVVVTGWIVWAWISIFSVLIGSFF*