3300005794: Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth

Overview

Basic Information

• IMG/M Taxon OID: 3300005794
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0112339 | Gp0119883 | Ga0079490
• Sample Name: Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth
• Sequencing Status: Permanent Draft
• Sequencing Center: The Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12994523
• Sequencing Scaffolds: 2
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → subglacial lake → lake sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: West Antarctica
• Coordinates
  • Lat. (^o): -84.24
  • Long. (^o): -153.694
  • Alt. (m): N/A
  • Depth (m): 0 to .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y
F063102	Metagenome	130	Y
F090572	Metagenome / Metatranscriptome	108	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0079490_100087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	4282
Ga0079490_100865	All Organisms → cellular organisms → Bacteria → Proteobacteria	1895

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079490_100087	Ga0079490_1000873	F025775	MKQFMSFQNFPMVVVTLMIIWAWISILSVLIASFF*
Ga0079490_100865	Ga0079490_1008653	F090572	MKRQTVILPFNLPRLTDKAAAQLLDLLHELIEGIEHHYAAQIHRYRKRQREMHQHRQSPPSTLTDSPF*
Ga0079490_111938	Ga0079490_1119381	F063102	VAEQIEFGFAGDVGVLPPMDHRLQGGGISVPKCFNESREGENC*