3300005643: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 3)

Overview

Basic Information

• IMG/M Taxon OID: 3300005643
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118793 | Gp0095085 | Ga0079369
• Sample Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 3)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 524145400
• Sequencing Scaffolds: 7
• Novel Protein Genes: 7
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Bioreactor Microbial Communities From Cape Town, South Africa
• Type: Engineered
• Taxonomy: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.927
  • Long. (^o): 18.452665
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0079369_1014793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4235
Ga0079369_1015908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	4128
Ga0079369_1027440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	3344
Ga0079369_1035643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2984
Ga0079369_1063271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	2258
Ga0079369_1112496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1608
Ga0079369_1267366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	631

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079369_1014793	Ga0079369_10147935	F025775	MKQFLTFQRFPMVVVVALIVWSWISILSVVIGSLF*
Ga0079369_1015908	Ga0079369_10159085	F025775	MKQLLTFQSFPMVVVTGLIIWAWISILSVLIASFF*
Ga0079369_1027440	Ga0079369_10274403	F025775	MKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF*
Ga0079369_1035643	Ga0079369_10356434	F025775	MKQFLPFQGFPMVVVVALIVWSWISILSVVIGSLF*
Ga0079369_1063271	Ga0079369_10632713	F025775	MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF*
Ga0079369_1112496	Ga0079369_11124964	F025775	MKQFLTFQGFPMVVVVALIVWSWISILSVVIGSLF*
Ga0079369_1267366	Ga0079369_12673662	F025775	MKQFLTFQGFPMVVVVALIVWSWISILSMVIGSLF*