3300027282: Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/9 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300027282
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0103000 | Gp0061305 | Ga0209346
• Sample Name: Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/9 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 185046412
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → borehole → clay soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Mt. Terri, Switzerland
• Coordinates
  • Lat. (^o): 47.379
  • Long. (^o): 7.1648
  • Alt. (m): N/A
  • Depth (m): 562.73

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y
F079376	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0209346_1010838	Not Available	1983
Ga0209346_1024916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	986

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209346_1010838	Ga0209346_10108382	F079376	MFDIVIRREPGRPCASFGVSRVCRTTEEGGRQMRHRESDSLVVPMKAGNAAGGKEATHGSAV
Ga0209346_1024916	Ga0209346_10249162	F025775	MKQFMTFQSFPMVVVTLMVIWAWVSILSVLIGSFF