3300003418: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof

Overview

Basic Information

• IMG/M Taxon OID: 3300003418
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118793 | Gp0095075 | Ga0041896
• Sample Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 171736237
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Bioreactor Microbial Communities From Cape Town, South Africa
• Type: Engineered
• Taxonomy: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.936637
  • Long. (^o): 18.478905
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y
F027211	Metagenome / Metatranscriptome	195	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI26523J50269_1010362	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium	2043
JGI26523J50269_1076542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	509

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI26523J50269_1010362	JGI26523J50269_10103622	F027211	MVRTYWFVPIFYEAIDILDLQPSARSDNVEACRPLGWCTTIVR*
JGI26523J50269_1076542	JGI26523J50269_10765421	F025775	MKQLLTFQSFPMVVVTGLIIWAWISILSVLIARSSDVARA