3300014814: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor

Overview

Basic Information

• IMG/M Taxon OID: 3300014814
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118793 | Gp0136317 | Ga0119849
• Sample Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor
• Sequencing Status: Permanent Draft
• Sequencing Center: Banfield Lab, University of California, Berkeley
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 193900343
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Bioreactor Microbial Communities From Cape Town, South Africa
• Type: Engineered
• Taxonomy: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: South Africa: University of Cape Town, Rondebosch
• Coordinates
  • Lat. (^o): -33.96
  • Long. (^o): 18.46
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0119849_1014733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1828

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119849_1014733	Ga0119849_10147331	F025775	ARTMKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF*