| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027283 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0103000 | Gp0061309 | Ga0209643 |
| Sample Name | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 287083245 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 2 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → borehole → clay soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Mt. Terri, Switzerland | |||||||
| Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025775 | Metagenome | 200 | Y |
| F028303 | Metagenome | 192 | Y |
| F049077 | Metagenome / Metatranscriptome | 147 | Y |
| F080453 | Metagenome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0209643_1000039 | All Organisms → cellular organisms → Bacteria | 381070 | Open in IMG/M |
| Ga0209643_1000415 | All Organisms → cellular organisms → Bacteria | 82047 | Open in IMG/M |
| Ga0209643_1044070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| Ga0209643_1057904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0209643_1000039 | Ga0209643_100003981 | F025775 | MKQLFTFQGFPMVVVVALVVWSWISILSVLIAAFF |
| Ga0209643_1000415 | Ga0209643_100041523 | F049077 | MDLDPFFPSMANTVGALLPALISFGIVLARRARSGLGLADQLWVIVVSIALSVALSRVTITPDVTALHFMPGATVALCYLVWCGHYISPGLAFATTYATCLPVDFFLAQLLFGADFNPESIGGAGWRDGLLVFPTLTALAVMYANWRSLHAGGTRLIGFGQQTGGHALDWARGHLKRHGVAGR |
| Ga0209643_1044070 | Ga0209643_10440701 | F028303 | MMTKIEVEISGELSRQIERIVRDGWFPSEEALAQEALQQFVEAKSFLGDSPRMLKRFAADALNESKPDTALKF |
| Ga0209643_1057904 | Ga0209643_10579042 | F080453 | AGPFQTRLWSRLQPAEGDDYFLSSVNFSETKHYVRKVMNSYRRYGEIYEGGPVSGGIPAE |
| ⦗Top⦘ |