Metagenome / Metatranscriptome Family F080090

Overview

Basic Information

• Family ID: F080090
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 115
• Average Sequence Length: 42 residues
• Representative Sequence: MIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR
• Number of Associated Samples: 108
• Number of Associated Scaffolds: 115

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Archaea
• % of genes with valid RBS motifs: 19.30 %
• % of genes near scaffold ends (potentially truncated): 96.52 %
• % of genes from short scaffolds (< 2000 bps): 80.00 %
• Associated GOLD sequencing projects: 102
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Archaea (79.130 % of family members)
• NCBI Taxonomy ID: 2157
• Taxonomy: All Organisms → cellular organisms → Archaea

Most Common Ecosystem

• GOLD Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (20.870 % of family members)
• Environment Ontology (ENVO): Unclassified (62.609 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (44.348 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 20.29%
  β-sheet: 0.00%
  Coil/Unstructured: 79.71%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 115 Family Scaffolds
PF01527	HTH_Tnp_1	33.04
PF13683	rve_3	20.87
PF13276	HTH_21	5.22
PF02386	TrkH	3.48
PF04055	Radical_SAM	1.74
PF12323	HTH_OrfB_IS605	1.74
PF02371	Transposase_20	1.74
PF00872	Transposase_mut	1.74
PF04326	AlbA_2	1.74
PF05154	TM2	0.87
PF13340	DUF4096	0.87
PF01895	PhoU	0.87
PF10049	DUF2283	0.87
PF13005	zf-IS66	0.87
PF13749	HATPase_c_4	0.87
PF07992	Pyr_redox_2	0.87
PF00535	Glycos_transf_2	0.87
PF06433	Me-amine-dh_H	0.87
PF00155	Aminotran_1_2	0.87
PF05598	DUF772	0.87
PF00282	Pyridoxal_deC	0.87
PF00400	WD40	0.87
PF04228	Zn_peptidase	0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 115 Family Scaffolds
COG0168	Trk-type K+ transport system, membrane component	Inorganic ion transport and metabolism [P]	3.48
COG2865	Predicted transcriptional regulator, contains HTH domain	Transcription [K]	1.74
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	1.74
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.74
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.87
COG2314	Uncharacterized membrane protein YozV, TM2 domain, contains pTyr	General function prediction only [R]	0.87
COG2321	Predicted metalloprotease	General function prediction only [R]	0.87

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.61 %
Unclassified	root	N/A	17.39 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.61 %
Unclassified	root	N/A	17.39 %

Level 3

Name	Rank	Taxonomy	Distribution
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	79.13 %
Unclassified	root	N/A	17.39 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.48 %

Level 4

Name	Rank	Taxonomy	Distribution
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	72.17 %
Unclassified	root	N/A	17.39 %
environmental samples	no rank	All Organisms → cellular organisms → Archaea → environmental samples	2.61 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	1.74 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.87 %

Level 5

Name	Rank	Taxonomy	Distribution
Stenosarchaea group	clade	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group	71.30 %
Unclassified	root	N/A	17.39 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota	phylum	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota	1.74 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.87 %

Level 6

Name	Rank	Taxonomy	Distribution
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	71.30 %
Unclassified	root	N/A	17.39 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.74 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.87 %

Level 7

Name	Rank	Taxonomy	Distribution
Methanotrichales	order	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales	70.43 %
Unclassified	root	N/A	17.39 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.74 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.87 %

Level 8

Name	Rank	Taxonomy	Distribution
Methanotrichaceae	family	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae	70.43 %
Unclassified	root	N/A	17.39 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.74 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	0.87 %

Level 9

Name	Rank	Taxonomy	Distribution
Methanothrix	genus	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	70.43 %
Unclassified	root	N/A	17.39 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.74 %
Brevifollis	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Brevifollis	0.87 %

Level 10

Name	Rank	Taxonomy	Distribution
Methanothrix soehngenii	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	58.26 %
Unclassified	root	N/A	17.39 %
unclassified Methanothrix	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix	4.35 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.74 %
Brevifollis gellanilyticus	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Brevifollis → Brevifollis gellanilyticus	0.87 %

Level 11

Name	Rank	Taxonomy	Distribution
Methanothrix soehngenii	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	58.26 %
Unclassified	root	N/A	17.39 %
Methanothrix sp.	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	3.48 %
uncultured archaeon	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	2.61 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.74 %
Methanosaeta sp. PtaU1.Bin112	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112	0.87 %
Brevifollis gellanilyticus	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Brevifollis → Brevifollis gellanilyticus	0.87 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001213|JGIcombinedJ13530_100886407	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	546
3300001580|Draft_10170467	All Organisms → cellular organisms → Bacteria	1027
3300002068|JGIcombinedJ21913_10183237	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	718
3300002219|SCADCLC_10003411	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	3764
3300002219|SCADCLC_10052897	All Organisms → cellular organisms → Archaea → Euryarchaeota	6202
3300005325|Ga0074199_1011223	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Brevifollis → Brevifollis gellanilyticus	2639
3300005665|Ga0074127_101880	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	4217
3300006389|Ga0079064_1058436	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1296
3300006433|Ga0100129_118943	All Organisms → cellular organisms → Bacteria	509
3300006434|Ga0100130_101852	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	2496
3300006652|Ga0101729_1041997	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	604
3300006659|Ga0101733_124510	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	593
3300006670|Ga0101737_135732	Not Available	523
3300006671|Ga0101734_107710	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1362
3300006833|Ga0101940_106556	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	2101
3300006885|Ga0102512_105136	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1316
3300007089|Ga0102622_1032365	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	797
3300009607|Ga0123327_1222836	Not Available	608
3300009647|Ga0123326_1040881	Not Available	1783
3300009656|Ga0123329_1235318	Not Available	650
3300009675|Ga0116149_1124591	Not Available	1286
3300009689|Ga0116186_1107662	All Organisms → cellular organisms → Bacteria	1373
3300009689|Ga0116186_1370901	Not Available	599
3300009692|Ga0116171_10069925	Not Available	2194
3300009707|Ga0116195_1014839	Not Available	2532
3300010351|Ga0116248_10942256	Not Available	590
3300010357|Ga0116249_10765108	Not Available	881
3300019217|Ga0179946_1019590	All Organisms → cellular organisms → Archaea	1415
3300019220|Ga0179936_1057501	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1376
3300019226|Ga0179934_1095519	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	725
3300019788|Ga0182028_1225852	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112	946
3300022593|Ga0236338_1026690	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1361
3300023311|Ga0256681_12086326	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1299
3300025279|Ga0208047_1028120	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	1597
3300025393|Ga0208041_1009541	Not Available	2500
3300025393|Ga0208041_1022538	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1233
3300025443|Ga0208081_1018064	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1308
3300025495|Ga0207932_1034025	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1256
3300025499|Ga0207931_1021649	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1452
3300025657|Ga0208823_1202916	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	509
3300025708|Ga0209201_1073696	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1320
3300025720|Ga0208197_1064479	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1429
3300025730|Ga0209606_1158129	Not Available	774
3300025739|Ga0209745_1002115	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	11457
3300025740|Ga0208940_1030746	Not Available	2555
3300025750|Ga0209747_1002997	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	8462
3300025807|Ga0208828_1068454	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	820
3300025836|Ga0209748_1004151	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	6861
3300025843|Ga0209182_10024965	All Organisms → cellular organisms → Archaea	1774
3300025846|Ga0209538_1131689	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	982
3300025866|Ga0208822_1079028	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1309
3300025867|Ga0209098_1215544	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	781
3300025882|Ga0209097_10116578	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1259
3300025902|Ga0209202_1212149	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	543
3300025967|Ga0210136_1008864	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1135
3300026370|Ga0256816_1013123	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	614
3300026389|Ga0247507_109085	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1299
3300026389|Ga0247507_127063	Not Available	503
3300027419|Ga0209340_1032908	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1367
3300027675|Ga0209077_1039461	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1286
3300027715|Ga0208665_10041906	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1313
3300027715|Ga0208665_10073160	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1030
3300027722|Ga0209819_10005405	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	4056
3300027731|Ga0209592_1061476	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1396
3300027871|Ga0209397_10115243	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1149
3300027887|Ga0208980_10523710	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	679
3300027896|Ga0209777_10451660	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	957
3300027899|Ga0209668_10183278	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1293
3300027899|Ga0209668_10282959	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1060
3300027972|Ga0209079_10179563	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	724
3300027979|Ga0209705_10171368	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1153
3300028032|Ga0265296_1154078	Not Available	832
(restricted) 3300028564|Ga0255344_1098210	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1332
(restricted) 3300028567|Ga0255342_1053265	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	2182
(restricted) 3300028567|Ga0255342_1076077	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	1674
(restricted) 3300028570|Ga0255341_1074197	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	1682
(restricted) 3300028593|Ga0255347_1128405	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1321
3300028624|Ga0302246_1101457	Not Available	584
3300028627|Ga0302243_1028836	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1431
3300028630|Ga0302247_1035084	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1484
3300028633|Ga0302236_1043844	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1196
3300028634|Ga0302242_1038600	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1345
3300028635|Ga0302245_1021342	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	2039
3300028638|Ga0302240_1024021	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1993
3300028640|Ga0302237_1033212	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1503
3300028641|Ga0302239_1037442	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1304
3300028644|Ga0302238_1034269	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1731
(restricted) 3300028677|Ga0255346_1099105	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1340
3300028903|Ga0302250_1077035	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix	500
3300028907|Ga0302252_1018746	Not Available	1486
3300029596|Ga0307345_103647	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1402
3300029959|Ga0272380_10662747	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	672
3300030000|Ga0311337_10085265	Not Available	2489
3300031232|Ga0302323_102223442	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	624
3300031577|Ga0316602_10060651	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	623
3300031997|Ga0315278_10404436	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1409
3300031999|Ga0315274_10528377	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1325
3300032177|Ga0315276_10846453	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	977
3300032401|Ga0315275_10489473	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1378
3300033165|Ga0334892_1025108	Not Available	2219
3300033169|Ga0334887_1004282	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	13116
3300033170|Ga0334884_1041868	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	2026
3300033172|Ga0334888_1044764	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1785
3300033173|Ga0334889_1009425	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	6627
3300033174|Ga0334882_1040557	All Organisms → cellular organisms → Archaea	1931
3300033176|Ga0334886_1046210	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1700
3300033177|Ga0334883_1064936	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1313
3300033178|Ga0334885_1058650	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1432
3300033419|Ga0316601_100328882	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1411
3300033428|Ga0334896_1030234	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1483
3300033827|Ga0334848_051984	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.	747
3300034195|Ga0370501_0053840	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	1285
3300034652|Ga0316598_020252	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	1689
3300034686|Ga0334891_005705	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii	8315

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Engineered	Engineered	56.52%
Environmental	Environmental	43.48%

Class

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	33.91%
Terrestrial	Environmental → Terrestrial	24.35%
Aquatic	Environmental → Aquatic	19.13%
Bioreactor	Engineered → Bioreactor	12.17%
Built Environment	Engineered → Built Environment	5.22%
Bioremediation	Engineered → Bioremediation	2.61%
Modeled	Engineered → Modeled	1.74%
Lab Enrichment	Engineered → Lab Enrichment	0.87%

Category

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	31.30%
Soil	Environmental → Terrestrial → Soil	19.13%
Freshwater	Environmental → Aquatic → Freshwater	17.39%
Anaerobic	Engineered → Bioreactor → Anaerobic	12.17%
Water Treatment Plant	Engineered → Built Environment → Water Treatment Plant	5.22%
Peat	Environmental → Terrestrial → Peat	2.61%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	2.61%
Tetrachloroethylene And Derivatives	Engineered → Bioremediation → Tetrachloroethylene And Derivatives	2.61%
Marine	Environmental → Aquatic → Marine	1.74%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.74%
Simulated Communities (Microbial Mixture)	Engineered → Modeled → Simulated Communities (Microbial Mixture)	1.74%
Oil Reservoir	Environmental → Terrestrial → Oil Reservoir	0.87%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.87%

Type

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	31.30%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	13.91%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	12.17%
Lake	Environmental → Aquatic → Freshwater → Lake	7.83%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.22%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.22%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified	5.22%
Lentic	Environmental → Aquatic → Freshwater → Lentic	2.61%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.61%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	2.61%
Tetrachloroethylene	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene	2.61%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.74%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.74%
Unclassified	Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified	1.74%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.87%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.87%
Unclassified	Environmental → Terrestrial → Oil Reservoir → Unclassified	0.87%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	0.87%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	31.30%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	12.17%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	6.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	6.96%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.22%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified	5.22%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.35%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.35%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	3.48%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	2.61%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.61%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	2.61%
Unclassified	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified	2.61%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	1.74%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.74%
Unclassified	Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified	1.74%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.87%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.87%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.87%
Unclassified	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified	0.87%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	0.87%

Habitat

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	20.87%
Activated Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge	10.43%
Sludge	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge	9.57%
Sediment	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment	6.96%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	6.96%
Wastewater	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater	5.22%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	4.35%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.48%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	2.61%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	2.61%
Anaerobic Biogas Reactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor	2.61%
Bioremediated Contaminated Groundwater	Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater	2.61%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.74%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.74%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	1.74%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.74%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.74%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.74%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.74%
Defined Medium	Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium	1.74%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.87%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	0.87%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.87%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.87%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.87%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.87%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.87%
Oil Sands	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands	0.87%
Sediment	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Sediment	0.87%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300001580	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6	Engineered
3300002068	Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)	Environmental
3300002219	Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:	Engineered
3300005325	Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47	Engineered
3300005665	Alkane-degrading methanogenic microbial communities from enrichment of sediment from a hydrocarbon-contaminated ditch in Bremen, Germany	Engineered
3300006389	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_03_SludgeMetaT (Metagenome Metatranscriptome)	Engineered
3300006433	T18 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times	Environmental
3300006434	T18 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times	Environmental
3300006652	Combined Assembly of Gp0123698, Gp0123960, Gp0123961	Environmental
3300006659	T10 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times	Environmental
3300006670	T14 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times	Environmental
3300006671	T10 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times	Environmental
3300006833	Combined Assembly of Gp0125117, Gp0125118, Gp0125119	Environmental
3300006885	Final time point T34 (3) (live) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum	Environmental
3300007089	Combined Assembly of 100 bp T18 (live) Gp0123698, Gp0123960, Gp0123961	Environmental
3300009607	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA	Engineered
3300009647	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA	Engineered
3300009656	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA	Engineered
3300009675	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG	Engineered
3300009689	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG	Engineered
3300009692	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG	Engineered
3300009694	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG	Engineered
3300009707	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG	Engineered
3300010351	AD_USPNca	Engineered
3300010357	AD_USSTca	Engineered
3300019217	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome)	Engineered
3300019220	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome)	Engineered
3300019226	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome)	Engineered
3300019788	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)	Environmental
3300022593	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2	Environmental
3300023311	Combined Assembly of Gp0281739, Gp0281740, Gp0281741	Environmental
3300025279	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes)	Environmental
3300025393	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes)	Engineered
3300025443	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-092012 (SPAdes)	Environmental
3300025495	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes)	Environmental
3300025499	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes)	Environmental
3300025657	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes)	Engineered
3300025708	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)	Engineered
3300025720	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes)	Engineered
3300025730	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes)	Engineered
3300025739	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)	Environmental
3300025740	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes)	Engineered
3300025750	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes)	Environmental
3300025807	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes)	Environmental
3300025836	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes)	Environmental
3300025843	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes)	Environmental
3300025846	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)	Environmental
3300025866	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes)	Engineered
3300025867	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes)	Engineered
3300025882	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes)	Engineered
3300025902	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes)	Engineered
3300025967	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes)	Environmental
3300026370	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F5	Environmental
3300026389	Metatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.12 (Metagenome Metatranscriptome)	Engineered
3300027419	Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23 (SPAdes)	Engineered
3300027675	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)	Environmental
3300027715	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)	Environmental
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental
3300027979	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)	Environmental
3300028032	Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1	Environmental
3300028564 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18	Engineered
3300028567 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14	Engineered
3300028570 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12	Engineered
3300028593 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24	Engineered
3300028624	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp	Engineered
3300028627	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met	Engineered
3300028630	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ile	Engineered
3300028633	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Gly	Engineered
3300028634	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Lys	Engineered
3300028635	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Thr	Engineered
3300028638	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_His	Engineered
3300028640	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ala	Engineered
3300028641	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Glu	Engineered
3300028644	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Asn	Engineered
3300028677 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22	Engineered
3300028903	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Asp	Engineered
3300028907	Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Leu	Engineered
3300029596	Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Arg2 (Metagenome Metatranscriptome)	Engineered
3300029959	EPA Superfund site combined assembly	Engineered
3300030000	I_Fen_N3 coassembly	Environmental
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental
3300031577	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT	Environmental
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental
3300033165	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_04-R3	Engineered
3300033169	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_18_07-R1	Engineered
3300033170	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_12_05 R1	Engineered
3300033172	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_3_08-R1	Engineered
3300033173	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_8_08-R1	Engineered
3300033174	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_04-R1	Engineered
3300033176	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_27_06-R1	Engineered
3300033177	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_09_05-R1	Engineered
3300033178	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_05-R1	Engineered
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental
3300033428	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_27_06-R3	Engineered
3300033827	Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9	Environmental
3300034195	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17	Environmental
3300034652	Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)	Environmental
3300034686	Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_08-R1	Engineered

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGIcombinedJ13530_1008864071	3300001213	Wetland	LYVFSWQWSEPLRVDNELSNINPWREIYEKDEAALRPSI
Draft_101704671	3300001580	Hydrocarbon Resource Environments	MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDI
JGIcombinedJ21913_101832373	3300002068	Arctic Peat Soil	WSEPLRVDNELSNINSWREVYEKDEAALRPSIQDISSS*
SCADCLC_100034115	3300002219	Hydrocarbon Resource Environments	MVRLESACWSEPLRVNQKAKQCRLMEEVHEEDPAALRPGLQDIS
SCADCLC_100528975	3300002219	Hydrocarbon Resource Environments	MLLHWSEPLRVDNELSNINSWREEHEKDEATLRPSIQDISSS*
Ga0074199_10112232	3300005325	Bioremediated Contaminated Groundwater	MMWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSSRT*
Ga0074127_1018805	3300005665	Sediment	MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISLAELEA
Ga0079064_10584363	3300006389	Anaerobic Digestor Sludge	WSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT*
Ga0100129_1189432	3300006433	Sediment	MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDIS
Ga0100130_1018526	3300006434	Sediment	MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISISR
Ga0101729_10419973	3300006652	Sediment	VEWSEPLRADKKLSNADSWREVHEEDQAALRPGLQDISISR
Ga0101733_1245102	3300006659	Sediment	MIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR
Ga0101737_1357321	3300006670	Sediment	MPSPCDVLETEEHWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR
Ga0101734_1077101	3300006671	Sediment	IHHHEWQRQQAMPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT*
Ga0101940_1065565	3300006833	Sediment	MNWSEPLRVDNELSNINSWREIHEKDEAALRPSIQDISSSRT
Ga0102512_1051361	3300006885	Oil Sands	LEMSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISISRT*
Ga0102622_10323651	3300007089	Sediment	WSEPLRVDNELSNINSWREVYEKDEVALRPSIQDISSI*
Ga0123327_12228362	3300009607	Anaerobic Biogas Reactor	MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0123326_10408814	3300009647	Anaerobic Biogas Reactor	VDKKLSNADSWREVHEEDQAALRPGLQDISISRTMDLAP*
Ga0123329_12353181	3300009656	Anaerobic Biogas Reactor	MPSWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS
Ga0116149_11245912	3300009675	Anaerobic Digestor Sludge	MGWSEPLRVDNELSNFNSWREIYEKDEAALRPCIQD
Ga0116186_11076623	3300009689	Anaerobic Digestor Sludge	MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISIS
Ga0116186_13709012	3300009689	Anaerobic Digestor Sludge	MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS
Ga0116171_100699251	3300009692	Anaerobic Digestor Sludge	MGTWSEPLRVDKKLSNANSWRETYEKDEAALRSRLQDIDTNR
Ga0116170_101825613	3300009694	Anaerobic Digestor Sludge	MNAFFDLLKMQVWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI
Ga0116195_10148391	3300009707	Anaerobic Digestor Sludge	MKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0116248_109422561	3300010351	Anaerobic Digestor Sludge	MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ
Ga0116249_107651081	3300010357	Anaerobic Digestor Sludge	MYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ
Ga0179946_10195904	3300019217	Anaerobic Digestor Sludge	VKLQQIWHATYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0179936_10575011	3300019220	Anaerobic Digestor Sludge	WSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0179934_10955193	3300019226	Anaerobic Digestor Sludge	WSEPLRVDNELSNINSLREMHEKDEATLRPSIQDISSSRT
Ga0182028_12258521	3300019788	Fen	MKKYIWSEPLRVDNELSNINSWREVYEKDEAALRPS
Ga0236338_10266901	3300022593	Freshwater	EPLRVDNELSNINSWREVYEKDEAALRPSIQDISSSRT
Ga0256681_120863261	3300023311	Freshwater	YWSEPLRVDNELSNINSWREVYEKDEAALRPRLQDIGNS
Ga0208047_10281205	3300025279	Freshwater	FWSEPLRVDNELSNFRPWRDLDEENEATLRPGVQDISSG
Ga0208041_10095412	3300025393	Anaerobic Digestor Sludge	MKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI
Ga0208041_10225381	3300025393	Anaerobic Digestor Sludge	LRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0208081_10180643	3300025443	Arctic Peat Soil	IWSEPLRVCNELSNINPWRNDDEEIEAALQQRIQDIGSYRT
Ga0207932_10340251	3300025495	Arctic Peat Soil	YDIGWSEPLQVDNELSNINSWREVYEKDEAALRPSIQDICSS
Ga0207931_10216494	3300025499	Arctic Peat Soil	EAWSEPLRVCNELSNINPWRNDDEEIEAALQQRIQDIGSYRT
Ga0208823_12029163	3300025657	Anaerobic Digestor Sludge	YSGKEQDTPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0209201_10736961	3300025708	Anaerobic Digestor Sludge	LEKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0208197_10644791	3300025720	Anaerobic Digestor Sludge	GNHRQGRWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0209606_11581291	3300025730	Anaerobic Digestor Sludge	MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQD
Ga0209745_100211511	3300025739	Arctic Peat Soil	MAAYWSEPLRVDNELSNINSWREVHEKDEAALRPSIQ
Ga0208940_10307464	3300025740	Anaerobic Digestor Sludge	MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI
Ga0209747_100299710	3300025750	Arctic Peat Soil	MSYTYVWSEPLRVDNELSNINSWREVHEKDEAALRPSI
Ga0208828_10684541	3300025807	Freshwater	ELEWSEPLRVDNELSNFHPWRDAYEENEATLRPGVQDISSG
Ga0209748_10041518	3300025836	Arctic Peat Soil	MEWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS
Ga0209182_100249651	3300025843	Lake Sediment	PVNISLALIWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS
Ga0209538_11316891	3300025846	Arctic Peat Soil	GIWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS
Ga0208822_10790283	3300025866	Anaerobic Digestor Sludge	CAWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0209098_12155441	3300025867	Anaerobic Digestor Sludge	MGTWSEPLRVDKKLSNANSWRETYEKDEAALRSRLQDID
Ga0209097_101165781	3300025882	Anaerobic Digestor Sludge	AWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0209202_12121493	3300025902	Anaerobic Digestor Sludge	EINLLDWSEPLRVDNELSNINSLREMHEKDEATLRPSIQDISSSRT
Ga0210136_10088641	3300025967	Natural And Restored Wetlands	LMSIRALMWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSSRT
Ga0256816_10131233	3300026370	Sediment	GWSEPLRVDNKLSNANSWRETYEEDEAALRSRLQDISTS
Ga0247507_1090851	3300026389	Defined Medium	YWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0247507_1270631	3300026389	Defined Medium	MYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0209340_10329081	3300027419	Bioremediated Contaminated Groundwater	AGDYHVGIKEVFWSEPLRVDKKLSNANSWREVHEENKAALRPRLQDINTC
Ga0209077_10394611	3300027675	Freshwater Sediment	GNWTEPLRVDNELSNANSWRESYEKDEAALRPRIQDINSS
Ga0208665_100419063	3300027715	Deep Subsurface	NTQWSEPLRVDNELSEINSWREAHEKDEAALRPSIQDISSS
Ga0208665_100731601	3300027715	Deep Subsurface	VLRTEWSEPLRVDKKLSNANSWREVHEENKAALRPRLQDINTC
Ga0209819_100054052	3300027722	Freshwater Sediment	MWWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSSRT
Ga0209592_10614763	3300027731	Freshwater Sediment	VWSEPLRVDDELSNVNSWREVHEKDEAALRPSLQDISSS
Ga0209397_101152431	3300027871	Wetland	TEGIAEWSEPLRVDNELSNINSWREMHEKDEATLRPSIQDISSSRT
Ga0208980_105237103	3300027887	Wetland	EPLRVDNELSNINSWREIYEKDEAALRPCIQDIGSSRT
Ga0209777_104516601	3300027896	Freshwater Lake Sediment	VHMSLDGIWSEPLRVDKTLSNANSWREVNEKDKAALQPRLQDISTG
Ga0209668_101832783	3300027899	Freshwater Lake Sediment	WSEPIRVDNELSEINSWREAHEKDEAALRPSIQDISSS
Ga0209668_102829591	3300027899	Freshwater Lake Sediment	EMLPRITNWSEPLRVDNELSNINSWREVYEKDEAALRPSIQDISSS
Ga0209079_101795631	3300027972	Freshwater Sediment	EPLRVDNELSNINSWREIHEKDEATLRPSIQDINSSRT
Ga0209705_101713683	3300027979	Freshwater Sediment	IKETIIWSEPLRVDDELSNVNSWREVHEKDEAALRPSLQDISSS
Ga0265296_11540781	3300028032	Groundwater	MLYNLLANTWSEPLRVDNELSNINSWREVYEKDEAALRP
(restricted) Ga0255344_10982101	3300028564	Wastewater	RTALWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
(restricted) Ga0255342_10532655	3300028567	Wastewater	MTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
(restricted) Ga0255342_10760771	3300028567	Wastewater	KDQEWSEPLRVDNELSNFNSWREIYEKDEAALRPCIQDIGNSRT
(restricted) Ga0255341_10741971	3300028570	Wastewater	FLKDQEWSEPLRVDNELSNFNSWREIYEKDEAALRPCIQDIGNSRT
(restricted) Ga0255347_11284051	3300028593	Wastewater	EKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302246_11014571	3300028624	Activated Sludge	MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI
Ga0302243_10288361	3300028627	Activated Sludge	LLFWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302247_10350844	3300028630	Activated Sludge	TPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302236_10438443	3300028633	Activated Sludge	GWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302242_10386001	3300028634	Activated Sludge	GKEQDTPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302245_10213424	3300028635	Activated Sludge	SWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302240_10240214	3300028638	Activated Sludge	ACAWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302237_10332124	3300028640	Activated Sludge	GREATLACAWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302239_10374423	3300028641	Activated Sludge	PWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302238_10342694	3300028644	Activated Sludge	VWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
(restricted) Ga0255346_10991053	3300028677	Wastewater	LMQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0302250_10770351	3300028903	Activated Sludge	SVVSRTPWSEPLRVDKKLSNANSWRKTYEEDEAAL
Ga0302252_10187461	3300028907	Activated Sludge	MKWSGCCWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS
Ga0307345_1036471	3300029596	Anaerobic Digestor Sludge	ERFILMRWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0272380_106627473	3300029959	Bioremediated Contaminated Groundwater	LWTAPLRVDNELSNDAQWRVAHEEDEAALRPRFQDISSS
Ga0311337_100852653	3300030000	Fen	LLADWSEPLRVDNELNNINSWKGVYEKDEAALRPSIQDIRSS
Ga0302323_1022234421	3300031232	Fen	LAWSEPLRVDNELSNINSWREVYEKDEAALRPSIQDISSS
Ga0316602_100606513	3300031577	Soil	NWSEPLRVDNELSNINSWREIHEKDEATLRPSIQDISSSRT
Ga0315278_104044363	3300031997	Sediment	NSAPTEKIWSEPLRVDKKLSNANTWREVHEENEAAFRPRIQDISNSRT
Ga0315274_105283771	3300031999	Sediment	VLGDIWSEPLRVDNELSNINSWRELHEKDEAALRPSFQDISSS
Ga0315276_108464533	3300032177	Sediment	SIWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS
Ga0315275_104894731	3300032401	Sediment	IWSEPLRVDNELSNINSWREAYEKDEAALRPSIQDISSS
Ga0334892_10251084	3300033165	Sludge	MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALR
Ga0334887_10042821	3300033169	Sludge	LLEKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS
Ga0334884_10418684	3300033170	Sludge	ALWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0334888_10447644	3300033172	Sludge	ERKTKKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0334889_10094257	3300033173	Sludge	MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ
Ga0334882_10405574	3300033174	Sludge	LGSLLSERKTKKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0334886_10462104	3300033176	Sludge	QRYEHDRHWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0334883_10649363	3300033177	Sludge	LRTALWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0334885_10586501	3300033178	Sludge	KLCTPEAPVHSWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0316601_1003288821	3300033419	Soil	KLLIWSEPLRVDNELSNINSWREVHEEDEAALRPRI
Ga0334896_10302343	3300033428	Sludge	FQELSCLLEKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT
Ga0334848_051984_624_746	3300033827	Soil	MKKYIWSEPLRVDNELSNINSWREVYEKDEAALRPSIQDIC
Ga0370501_0053840_1170_1283	3300034195	Untreated Peat Soil	MPILMEWSEPLRVDNELSNINSWREVHEKDEAALRPSI
Ga0316598_020252_1_153	3300034652	Untreated Peat Soil	HRVLNSSLTQMPWSEPLQVDNELSNINSWGEVYEKDEAALRPSIQDISSS
Ga0334891_005705_8193_8315	3300034686	Sludge	MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDI