| Basic Information | |
|---|---|
| Family ID | F080090 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 19.30 % |
| % of genes near scaffold ends (potentially truncated) | 96.52 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (79.130 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (20.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.609 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.348 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01527 | HTH_Tnp_1 | 33.04 |
| PF13683 | rve_3 | 20.87 |
| PF13276 | HTH_21 | 5.22 |
| PF02386 | TrkH | 3.48 |
| PF04055 | Radical_SAM | 1.74 |
| PF12323 | HTH_OrfB_IS605 | 1.74 |
| PF02371 | Transposase_20 | 1.74 |
| PF00872 | Transposase_mut | 1.74 |
| PF04326 | AlbA_2 | 1.74 |
| PF05154 | TM2 | 0.87 |
| PF13340 | DUF4096 | 0.87 |
| PF01895 | PhoU | 0.87 |
| PF10049 | DUF2283 | 0.87 |
| PF13005 | zf-IS66 | 0.87 |
| PF13749 | HATPase_c_4 | 0.87 |
| PF07992 | Pyr_redox_2 | 0.87 |
| PF00535 | Glycos_transf_2 | 0.87 |
| PF06433 | Me-amine-dh_H | 0.87 |
| PF00155 | Aminotran_1_2 | 0.87 |
| PF05598 | DUF772 | 0.87 |
| PF00282 | Pyridoxal_deC | 0.87 |
| PF00400 | WD40 | 0.87 |
| PF04228 | Zn_peptidase | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0168 | Trk-type K+ transport system, membrane component | Inorganic ion transport and metabolism [P] | 3.48 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 1.74 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.74 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.87 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 0.87 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.61 % |
| Unclassified | root | N/A | 17.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100886407 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 546 | Open in IMG/M |
| 3300001580|Draft_10170467 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10183237 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 718 | Open in IMG/M |
| 3300002219|SCADCLC_10003411 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 3764 | Open in IMG/M |
| 3300002219|SCADCLC_10052897 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 6202 | Open in IMG/M |
| 3300005325|Ga0074199_1011223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Brevifollis → Brevifollis gellanilyticus | 2639 | Open in IMG/M |
| 3300005665|Ga0074127_101880 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 4217 | Open in IMG/M |
| 3300006389|Ga0079064_1058436 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1296 | Open in IMG/M |
| 3300006433|Ga0100129_118943 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006434|Ga0100130_101852 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2496 | Open in IMG/M |
| 3300006652|Ga0101729_1041997 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 604 | Open in IMG/M |
| 3300006659|Ga0101733_124510 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 593 | Open in IMG/M |
| 3300006670|Ga0101737_135732 | Not Available | 523 | Open in IMG/M |
| 3300006671|Ga0101734_107710 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1362 | Open in IMG/M |
| 3300006833|Ga0101940_106556 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 2101 | Open in IMG/M |
| 3300006885|Ga0102512_105136 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1316 | Open in IMG/M |
| 3300007089|Ga0102622_1032365 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 797 | Open in IMG/M |
| 3300009607|Ga0123327_1222836 | Not Available | 608 | Open in IMG/M |
| 3300009647|Ga0123326_1040881 | Not Available | 1783 | Open in IMG/M |
| 3300009656|Ga0123329_1235318 | Not Available | 650 | Open in IMG/M |
| 3300009675|Ga0116149_1124591 | Not Available | 1286 | Open in IMG/M |
| 3300009689|Ga0116186_1107662 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300009689|Ga0116186_1370901 | Not Available | 599 | Open in IMG/M |
| 3300009692|Ga0116171_10069925 | Not Available | 2194 | Open in IMG/M |
| 3300009707|Ga0116195_1014839 | Not Available | 2532 | Open in IMG/M |
| 3300010351|Ga0116248_10942256 | Not Available | 590 | Open in IMG/M |
| 3300010357|Ga0116249_10765108 | Not Available | 881 | Open in IMG/M |
| 3300019217|Ga0179946_1019590 | All Organisms → cellular organisms → Archaea | 1415 | Open in IMG/M |
| 3300019220|Ga0179936_1057501 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1376 | Open in IMG/M |
| 3300019226|Ga0179934_1095519 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 725 | Open in IMG/M |
| 3300019788|Ga0182028_1225852 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 946 | Open in IMG/M |
| 3300022593|Ga0236338_1026690 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1361 | Open in IMG/M |
| 3300023311|Ga0256681_12086326 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1299 | Open in IMG/M |
| 3300025279|Ga0208047_1028120 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1597 | Open in IMG/M |
| 3300025393|Ga0208041_1009541 | Not Available | 2500 | Open in IMG/M |
| 3300025393|Ga0208041_1022538 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1233 | Open in IMG/M |
| 3300025443|Ga0208081_1018064 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1308 | Open in IMG/M |
| 3300025495|Ga0207932_1034025 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1256 | Open in IMG/M |
| 3300025499|Ga0207931_1021649 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1452 | Open in IMG/M |
| 3300025657|Ga0208823_1202916 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 509 | Open in IMG/M |
| 3300025708|Ga0209201_1073696 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1320 | Open in IMG/M |
| 3300025720|Ga0208197_1064479 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1429 | Open in IMG/M |
| 3300025730|Ga0209606_1158129 | Not Available | 774 | Open in IMG/M |
| 3300025739|Ga0209745_1002115 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 11457 | Open in IMG/M |
| 3300025740|Ga0208940_1030746 | Not Available | 2555 | Open in IMG/M |
| 3300025750|Ga0209747_1002997 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 8462 | Open in IMG/M |
| 3300025807|Ga0208828_1068454 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 820 | Open in IMG/M |
| 3300025836|Ga0209748_1004151 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 6861 | Open in IMG/M |
| 3300025843|Ga0209182_10024965 | All Organisms → cellular organisms → Archaea | 1774 | Open in IMG/M |
| 3300025846|Ga0209538_1131689 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 982 | Open in IMG/M |
| 3300025866|Ga0208822_1079028 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1309 | Open in IMG/M |
| 3300025867|Ga0209098_1215544 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 781 | Open in IMG/M |
| 3300025882|Ga0209097_10116578 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1259 | Open in IMG/M |
| 3300025902|Ga0209202_1212149 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 543 | Open in IMG/M |
| 3300025967|Ga0210136_1008864 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1135 | Open in IMG/M |
| 3300026370|Ga0256816_1013123 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 614 | Open in IMG/M |
| 3300026389|Ga0247507_109085 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1299 | Open in IMG/M |
| 3300026389|Ga0247507_127063 | Not Available | 503 | Open in IMG/M |
| 3300027419|Ga0209340_1032908 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1367 | Open in IMG/M |
| 3300027675|Ga0209077_1039461 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1286 | Open in IMG/M |
| 3300027715|Ga0208665_10041906 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1313 | Open in IMG/M |
| 3300027715|Ga0208665_10073160 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1030 | Open in IMG/M |
| 3300027722|Ga0209819_10005405 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 4056 | Open in IMG/M |
| 3300027731|Ga0209592_1061476 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1396 | Open in IMG/M |
| 3300027871|Ga0209397_10115243 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1149 | Open in IMG/M |
| 3300027887|Ga0208980_10523710 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 679 | Open in IMG/M |
| 3300027896|Ga0209777_10451660 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 957 | Open in IMG/M |
| 3300027899|Ga0209668_10183278 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1293 | Open in IMG/M |
| 3300027899|Ga0209668_10282959 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1060 | Open in IMG/M |
| 3300027972|Ga0209079_10179563 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 724 | Open in IMG/M |
| 3300027979|Ga0209705_10171368 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1153 | Open in IMG/M |
| 3300028032|Ga0265296_1154078 | Not Available | 832 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1098210 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1332 | Open in IMG/M |
| (restricted) 3300028567|Ga0255342_1053265 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 2182 | Open in IMG/M |
| (restricted) 3300028567|Ga0255342_1076077 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1674 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1074197 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1682 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1128405 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1321 | Open in IMG/M |
| 3300028624|Ga0302246_1101457 | Not Available | 584 | Open in IMG/M |
| 3300028627|Ga0302243_1028836 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1431 | Open in IMG/M |
| 3300028630|Ga0302247_1035084 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1484 | Open in IMG/M |
| 3300028633|Ga0302236_1043844 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1196 | Open in IMG/M |
| 3300028634|Ga0302242_1038600 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1345 | Open in IMG/M |
| 3300028635|Ga0302245_1021342 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 2039 | Open in IMG/M |
| 3300028638|Ga0302240_1024021 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1993 | Open in IMG/M |
| 3300028640|Ga0302237_1033212 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1503 | Open in IMG/M |
| 3300028641|Ga0302239_1037442 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1304 | Open in IMG/M |
| 3300028644|Ga0302238_1034269 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1731 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1099105 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1340 | Open in IMG/M |
| 3300028903|Ga0302250_1077035 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 500 | Open in IMG/M |
| 3300028907|Ga0302252_1018746 | Not Available | 1486 | Open in IMG/M |
| 3300029596|Ga0307345_103647 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1402 | Open in IMG/M |
| 3300029959|Ga0272380_10662747 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 672 | Open in IMG/M |
| 3300030000|Ga0311337_10085265 | Not Available | 2489 | Open in IMG/M |
| 3300031232|Ga0302323_102223442 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 624 | Open in IMG/M |
| 3300031577|Ga0316602_10060651 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 623 | Open in IMG/M |
| 3300031997|Ga0315278_10404436 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1409 | Open in IMG/M |
| 3300031999|Ga0315274_10528377 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1325 | Open in IMG/M |
| 3300032177|Ga0315276_10846453 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 977 | Open in IMG/M |
| 3300032401|Ga0315275_10489473 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1378 | Open in IMG/M |
| 3300033165|Ga0334892_1025108 | Not Available | 2219 | Open in IMG/M |
| 3300033169|Ga0334887_1004282 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 13116 | Open in IMG/M |
| 3300033170|Ga0334884_1041868 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 2026 | Open in IMG/M |
| 3300033172|Ga0334888_1044764 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1785 | Open in IMG/M |
| 3300033173|Ga0334889_1009425 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 6627 | Open in IMG/M |
| 3300033174|Ga0334882_1040557 | All Organisms → cellular organisms → Archaea | 1931 | Open in IMG/M |
| 3300033176|Ga0334886_1046210 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1700 | Open in IMG/M |
| 3300033177|Ga0334883_1064936 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1313 | Open in IMG/M |
| 3300033178|Ga0334885_1058650 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1432 | Open in IMG/M |
| 3300033419|Ga0316601_100328882 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1411 | Open in IMG/M |
| 3300033428|Ga0334896_1030234 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1483 | Open in IMG/M |
| 3300033827|Ga0334848_051984 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 747 | Open in IMG/M |
| 3300034195|Ga0370501_0053840 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 1285 | Open in IMG/M |
| 3300034652|Ga0316598_020252 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1689 | Open in IMG/M |
| 3300034686|Ga0334891_005705 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 8315 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 20.87% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 10.43% |
| Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge | 9.57% |
| Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 6.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 6.96% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 5.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.35% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.48% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.61% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 2.61% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 2.61% |
| Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 2.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.74% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.74% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.74% |
| Defined Medium | Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium | 1.74% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.87% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.87% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.87% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.87% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.87% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
| Oil Sands | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands | 0.87% |
| Sediment | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Sediment | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002219 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
| 3300005325 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 | Engineered | Open in IMG/M |
| 3300005665 | Alkane-degrading methanogenic microbial communities from enrichment of sediment from a hydrocarbon-contaminated ditch in Bremen, Germany | Engineered | Open in IMG/M |
| 3300006389 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006433 | T18 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006434 | T18 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006652 | Combined Assembly of Gp0123698, Gp0123960, Gp0123961 | Environmental | Open in IMG/M |
| 3300006659 | T10 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006670 | T14 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006671 | T10 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006833 | Combined Assembly of Gp0125117, Gp0125118, Gp0125119 | Environmental | Open in IMG/M |
| 3300006885 | Final time point T34 (3) (live) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum | Environmental | Open in IMG/M |
| 3300007089 | Combined Assembly of 100 bp T18 (live) Gp0123698, Gp0123960, Gp0123961 | Environmental | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009656 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009707 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300019217 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019220 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300025279 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes) | Environmental | Open in IMG/M |
| 3300025393 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025443 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025499 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025740 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025807 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes) | Environmental | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025867 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025882 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025902 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025967 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026370 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F5 | Environmental | Open in IMG/M |
| 3300026389 | Metatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.12 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300027419 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23 (SPAdes) | Engineered | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028624 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp | Engineered | Open in IMG/M |
| 3300028627 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met | Engineered | Open in IMG/M |
| 3300028630 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ile | Engineered | Open in IMG/M |
| 3300028633 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Gly | Engineered | Open in IMG/M |
| 3300028634 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Lys | Engineered | Open in IMG/M |
| 3300028635 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Thr | Engineered | Open in IMG/M |
| 3300028638 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_His | Engineered | Open in IMG/M |
| 3300028640 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ala | Engineered | Open in IMG/M |
| 3300028641 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Glu | Engineered | Open in IMG/M |
| 3300028644 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Asn | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300028903 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Asp | Engineered | Open in IMG/M |
| 3300028907 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Leu | Engineered | Open in IMG/M |
| 3300029596 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Arg2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029959 | EPA Superfund site combined assembly | Engineered | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031577 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033165 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_04-R3 | Engineered | Open in IMG/M |
| 3300033169 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_18_07-R1 | Engineered | Open in IMG/M |
| 3300033170 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_12_05 R1 | Engineered | Open in IMG/M |
| 3300033172 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_3_08-R1 | Engineered | Open in IMG/M |
| 3300033173 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_8_08-R1 | Engineered | Open in IMG/M |
| 3300033174 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_04-R1 | Engineered | Open in IMG/M |
| 3300033176 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_27_06-R1 | Engineered | Open in IMG/M |
| 3300033177 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_09_05-R1 | Engineered | Open in IMG/M |
| 3300033178 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_31_05-R1 | Engineered | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033428 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_27_06-R3 | Engineered | Open in IMG/M |
| 3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034686 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_15_08-R1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1008864071 | 3300001213 | Wetland | LYVFSWQWSEPLRVDNELSNINPWREIYEKDEAALRPSI |
| Draft_101704671 | 3300001580 | Hydrocarbon Resource Environments | MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDI |
| JGIcombinedJ21913_101832373 | 3300002068 | Arctic Peat Soil | WSEPLRVDNELSNINSWREVYEKDEAALRPSIQDISSS* |
| SCADCLC_100034115 | 3300002219 | Hydrocarbon Resource Environments | MVRLESACWSEPLRVNQKAKQCRLMEEVHEEDPAALRPGLQDIS |
| SCADCLC_100528975 | 3300002219 | Hydrocarbon Resource Environments | MLLHWSEPLRVDNELSNINSWREEHEKDEATLRPSIQDISSS* |
| Ga0074199_10112232 | 3300005325 | Bioremediated Contaminated Groundwater | MMWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSSRT* |
| Ga0074127_1018805 | 3300005665 | Sediment | MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISLAELEA |
| Ga0079064_10584363 | 3300006389 | Anaerobic Digestor Sludge | WSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT* |
| Ga0100129_1189432 | 3300006433 | Sediment | MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDIS |
| Ga0100130_1018526 | 3300006434 | Sediment | MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISISR |
| Ga0101729_10419973 | 3300006652 | Sediment | VEWSEPLRADKKLSNADSWREVHEEDQAALRPGLQDISISR |
| Ga0101733_1245102 | 3300006659 | Sediment | MIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR |
| Ga0101737_1357321 | 3300006670 | Sediment | MPSPCDVLETEEHWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISR |
| Ga0101734_1077101 | 3300006671 | Sediment | IHHHEWQRQQAMPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT* |
| Ga0101940_1065565 | 3300006833 | Sediment | MNWSEPLRVDNELSNINSWREIHEKDEAALRPSIQDISSSRT |
| Ga0102512_1051361 | 3300006885 | Oil Sands | LEMSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISISRT* |
| Ga0102622_10323651 | 3300007089 | Sediment | WSEPLRVDNELSNINSWREVYEKDEVALRPSIQDISSI* |
| Ga0123327_12228362 | 3300009607 | Anaerobic Biogas Reactor | MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0123326_10408814 | 3300009647 | Anaerobic Biogas Reactor | VDKKLSNADSWREVHEEDQAALRPGLQDISISRTMDLAP* |
| Ga0123329_12353181 | 3300009656 | Anaerobic Biogas Reactor | MPSWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS |
| Ga0116149_11245912 | 3300009675 | Anaerobic Digestor Sludge | MGWSEPLRVDNELSNFNSWREIYEKDEAALRPCIQD |
| Ga0116186_11076623 | 3300009689 | Anaerobic Digestor Sludge | MSEQWSEPLRMDKKLSNADSWREVHEEDQAALRPGLQDISIS |
| Ga0116186_13709012 | 3300009689 | Anaerobic Digestor Sludge | MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS |
| Ga0116171_100699251 | 3300009692 | Anaerobic Digestor Sludge | MGTWSEPLRVDKKLSNANSWRETYEKDEAALRSRLQDIDTNR |
| Ga0116170_101825613 | 3300009694 | Anaerobic Digestor Sludge | MNAFFDLLKMQVWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI |
| Ga0116195_10148391 | 3300009707 | Anaerobic Digestor Sludge | MKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0116248_109422561 | 3300010351 | Anaerobic Digestor Sludge | MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ |
| Ga0116249_107651081 | 3300010357 | Anaerobic Digestor Sludge | MYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ |
| Ga0179946_10195904 | 3300019217 | Anaerobic Digestor Sludge | VKLQQIWHATYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0179936_10575011 | 3300019220 | Anaerobic Digestor Sludge | WSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0179934_10955193 | 3300019226 | Anaerobic Digestor Sludge | WSEPLRVDNELSNINSLREMHEKDEATLRPSIQDISSSRT |
| Ga0182028_12258521 | 3300019788 | Fen | MKKYIWSEPLRVDNELSNINSWREVYEKDEAALRPS |
| Ga0236338_10266901 | 3300022593 | Freshwater | EPLRVDNELSNINSWREVYEKDEAALRPSIQDISSSRT |
| Ga0256681_120863261 | 3300023311 | Freshwater | YWSEPLRVDNELSNINSWREVYEKDEAALRPRLQDIGNS |
| Ga0208047_10281205 | 3300025279 | Freshwater | FWSEPLRVDNELSNFRPWRDLDEENEATLRPGVQDISSG |
| Ga0208041_10095412 | 3300025393 | Anaerobic Digestor Sludge | MKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI |
| Ga0208041_10225381 | 3300025393 | Anaerobic Digestor Sludge | LRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0208081_10180643 | 3300025443 | Arctic Peat Soil | IWSEPLRVCNELSNINPWRNDDEEIEAALQQRIQDIGSYRT |
| Ga0207932_10340251 | 3300025495 | Arctic Peat Soil | YDIGWSEPLQVDNELSNINSWREVYEKDEAALRPSIQDICSS |
| Ga0207931_10216494 | 3300025499 | Arctic Peat Soil | EAWSEPLRVCNELSNINPWRNDDEEIEAALQQRIQDIGSYRT |
| Ga0208823_12029163 | 3300025657 | Anaerobic Digestor Sludge | YSGKEQDTPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0209201_10736961 | 3300025708 | Anaerobic Digestor Sludge | LEKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0208197_10644791 | 3300025720 | Anaerobic Digestor Sludge | GNHRQGRWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0209606_11581291 | 3300025730 | Anaerobic Digestor Sludge | MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQD |
| Ga0209745_100211511 | 3300025739 | Arctic Peat Soil | MAAYWSEPLRVDNELSNINSWREVHEKDEAALRPSIQ |
| Ga0208940_10307464 | 3300025740 | Anaerobic Digestor Sludge | MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI |
| Ga0209747_100299710 | 3300025750 | Arctic Peat Soil | MSYTYVWSEPLRVDNELSNINSWREVHEKDEAALRPSI |
| Ga0208828_10684541 | 3300025807 | Freshwater | ELEWSEPLRVDNELSNFHPWRDAYEENEATLRPGVQDISSG |
| Ga0209748_10041518 | 3300025836 | Arctic Peat Soil | MEWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS |
| Ga0209182_100249651 | 3300025843 | Lake Sediment | PVNISLALIWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS |
| Ga0209538_11316891 | 3300025846 | Arctic Peat Soil | GIWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS |
| Ga0208822_10790283 | 3300025866 | Anaerobic Digestor Sludge | CAWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0209098_12155441 | 3300025867 | Anaerobic Digestor Sludge | MGTWSEPLRVDKKLSNANSWRETYEKDEAALRSRLQDID |
| Ga0209097_101165781 | 3300025882 | Anaerobic Digestor Sludge | AWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0209202_12121493 | 3300025902 | Anaerobic Digestor Sludge | EINLLDWSEPLRVDNELSNINSLREMHEKDEATLRPSIQDISSSRT |
| Ga0210136_10088641 | 3300025967 | Natural And Restored Wetlands | LMSIRALMWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSSRT |
| Ga0256816_10131233 | 3300026370 | Sediment | GWSEPLRVDNKLSNANSWRETYEEDEAALRSRLQDISTS |
| Ga0247507_1090851 | 3300026389 | Defined Medium | YWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0247507_1270631 | 3300026389 | Defined Medium | MYWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0209340_10329081 | 3300027419 | Bioremediated Contaminated Groundwater | AGDYHVGIKEVFWSEPLRVDKKLSNANSWREVHEENKAALRPRLQDINTC |
| Ga0209077_10394611 | 3300027675 | Freshwater Sediment | GNWTEPLRVDNELSNANSWRESYEKDEAALRPRIQDINSS |
| Ga0208665_100419063 | 3300027715 | Deep Subsurface | NTQWSEPLRVDNELSEINSWREAHEKDEAALRPSIQDISSS |
| Ga0208665_100731601 | 3300027715 | Deep Subsurface | VLRTEWSEPLRVDKKLSNANSWREVHEENKAALRPRLQDINTC |
| Ga0209819_100054052 | 3300027722 | Freshwater Sediment | MWWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSSRT |
| Ga0209592_10614763 | 3300027731 | Freshwater Sediment | VWSEPLRVDDELSNVNSWREVHEKDEAALRPSLQDISSS |
| Ga0209397_101152431 | 3300027871 | Wetland | TEGIAEWSEPLRVDNELSNINSWREMHEKDEATLRPSIQDISSSRT |
| Ga0208980_105237103 | 3300027887 | Wetland | EPLRVDNELSNINSWREIYEKDEAALRPCIQDIGSSRT |
| Ga0209777_104516601 | 3300027896 | Freshwater Lake Sediment | VHMSLDGIWSEPLRVDKTLSNANSWREVNEKDKAALQPRLQDISTG |
| Ga0209668_101832783 | 3300027899 | Freshwater Lake Sediment | WSEPIRVDNELSEINSWREAHEKDEAALRPSIQDISSS |
| Ga0209668_102829591 | 3300027899 | Freshwater Lake Sediment | EMLPRITNWSEPLRVDNELSNINSWREVYEKDEAALRPSIQDISSS |
| Ga0209079_101795631 | 3300027972 | Freshwater Sediment | EPLRVDNELSNINSWREIHEKDEATLRPSIQDINSSRT |
| Ga0209705_101713683 | 3300027979 | Freshwater Sediment | IKETIIWSEPLRVDDELSNVNSWREVHEKDEAALRPSLQDISSS |
| Ga0265296_11540781 | 3300028032 | Groundwater | MLYNLLANTWSEPLRVDNELSNINSWREVYEKDEAALRP |
| (restricted) Ga0255344_10982101 | 3300028564 | Wastewater | RTALWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| (restricted) Ga0255342_10532655 | 3300028567 | Wastewater | MTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| (restricted) Ga0255342_10760771 | 3300028567 | Wastewater | KDQEWSEPLRVDNELSNFNSWREIYEKDEAALRPCIQDIGNSRT |
| (restricted) Ga0255341_10741971 | 3300028570 | Wastewater | FLKDQEWSEPLRVDNELSNFNSWREIYEKDEAALRPCIQDIGNSRT |
| (restricted) Ga0255347_11284051 | 3300028593 | Wastewater | EKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302246_11014571 | 3300028624 | Activated Sludge | MAPMTMIWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISI |
| Ga0302243_10288361 | 3300028627 | Activated Sludge | LLFWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302247_10350844 | 3300028630 | Activated Sludge | TPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302236_10438443 | 3300028633 | Activated Sludge | GWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302242_10386001 | 3300028634 | Activated Sludge | GKEQDTPWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302245_10213424 | 3300028635 | Activated Sludge | SWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302240_10240214 | 3300028638 | Activated Sludge | ACAWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302237_10332124 | 3300028640 | Activated Sludge | GREATLACAWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302239_10374423 | 3300028641 | Activated Sludge | PWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302238_10342694 | 3300028644 | Activated Sludge | VWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| (restricted) Ga0255346_10991053 | 3300028677 | Wastewater | LMQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0302250_10770351 | 3300028903 | Activated Sludge | SVVSRTPWSEPLRVDKKLSNANSWRKTYEEDEAAL |
| Ga0302252_10187461 | 3300028907 | Activated Sludge | MKWSGCCWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS |
| Ga0307345_1036471 | 3300029596 | Anaerobic Digestor Sludge | ERFILMRWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0272380_106627473 | 3300029959 | Bioremediated Contaminated Groundwater | LWTAPLRVDNELSNDAQWRVAHEEDEAALRPRFQDISSS |
| Ga0311337_100852653 | 3300030000 | Fen | LLADWSEPLRVDNELNNINSWKGVYEKDEAALRPSIQDIRSS |
| Ga0302323_1022234421 | 3300031232 | Fen | LAWSEPLRVDNELSNINSWREVYEKDEAALRPSIQDISSS |
| Ga0316602_100606513 | 3300031577 | Soil | NWSEPLRVDNELSNINSWREIHEKDEATLRPSIQDISSSRT |
| Ga0315278_104044363 | 3300031997 | Sediment | NSAPTEKIWSEPLRVDKKLSNANTWREVHEENEAAFRPRIQDISNSRT |
| Ga0315274_105283771 | 3300031999 | Sediment | VLGDIWSEPLRVDNELSNINSWRELHEKDEAALRPSFQDISSS |
| Ga0315276_108464533 | 3300032177 | Sediment | SIWSEPLRVDNELSNINSWREVHEKDEAALRPSIQDISSS |
| Ga0315275_104894731 | 3300032401 | Sediment | IWSEPLRVDNELSNINSWREAYEKDEAALRPSIQDISSS |
| Ga0334892_10251084 | 3300033165 | Sludge | MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALR |
| Ga0334887_10042821 | 3300033169 | Sludge | LLEKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISIS |
| Ga0334884_10418684 | 3300033170 | Sludge | ALWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0334888_10447644 | 3300033172 | Sludge | ERKTKKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0334889_10094257 | 3300033173 | Sludge | MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQ |
| Ga0334882_10405574 | 3300033174 | Sludge | LGSLLSERKTKKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0334886_10462104 | 3300033176 | Sludge | QRYEHDRHWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0334883_10649363 | 3300033177 | Sludge | LRTALWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0334885_10586501 | 3300033178 | Sludge | KLCTPEAPVHSWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0316601_1003288821 | 3300033419 | Soil | KLLIWSEPLRVDNELSNINSWREVHEEDEAALRPRI |
| Ga0334896_10302343 | 3300033428 | Sludge | FQELSCLLEKWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISISRT |
| Ga0334848_051984_624_746 | 3300033827 | Soil | MKKYIWSEPLRVDNELSNINSWREVYEKDEAALRPSIQDIC |
| Ga0370501_0053840_1170_1283 | 3300034195 | Untreated Peat Soil | MPILMEWSEPLRVDNELSNINSWREVHEKDEAALRPSI |
| Ga0316598_020252_1_153 | 3300034652 | Untreated Peat Soil | HRVLNSSLTQMPWSEPLQVDNELSNINSWGEVYEKDEAALRPSIQDISSS |
| Ga0334891_005705_8193_8315 | 3300034686 | Sludge | MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDI |
| ⦗Top⦘ |