| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005665 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114765 | Gp0115703 | Ga0074127 |
| Sample Name | Alkane-degrading methanogenic microbial communities from enrichment of sediment from a hydrocarbon-contaminated ditch in Bremen, Germany |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, San Diego |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 50624176 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Alkane-Degrading Methanogenic Microbial Community From Enrichment |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Sediment → Alkane-Degrading Methanogenic Microbial Community From Enrichment |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bremen, Germany | |||||||
| Coordinates | Lat. (o) | 53.079854 | Long. (o) | 8.806667 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020363 | Metagenome / Metatranscriptome | 224 | Y |
| F045728 | Metagenome / Metatranscriptome | 152 | Y |
| F080090 | Metagenome / Metatranscriptome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074127_101213 | All Organisms → cellular organisms → Bacteria | 5971 | Open in IMG/M |
| Ga0074127_101880 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 4217 | Open in IMG/M |
| Ga0074127_105481 | Not Available | 1649 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074127_101213 | Ga0074127_1012134 | F045728 | MQLASAPREAYGQNERPSMAVQAAPAPAGDPLLVSRFLPTRE* |
| Ga0074127_101880 | Ga0074127_1018805 | F080090 | MQQGDGWSEPLRVDKKLSNADSWREVHEEDQAALRPGLQDISLAELEA |
| Ga0074127_105481 | Ga0074127_1054811 | F020363 | MCLLPCVAVARVFALVVRCRVIQLLLYSRVGKNRDTKRESPGGAGAARTAGHLTFLFSQKILAVRKGNDIYRPVRPRFI |
| ⦗Top⦘ |