 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F063612 |
| Family Type | Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LKSVAGGSPADKATSVAAESGLKTPRRETGSKEGVYSSAL |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (75.969 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 75.97% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 13.95% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.78% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.78% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003554 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005579 | Marine microbial communities from the Deep Indian Ocean - MP1372 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006693 | Marine microbial communities from the Deep Atlantic Ocean - MP0437 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006697 | Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP0895 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006698 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2049 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006711 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP2255 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006721 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 250_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006727 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0619 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006729 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 250_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006732 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 250_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007213 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 NT10 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007336 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007340 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007612 | Marine microbial communities from the Southern Atlantic ocean - KN S19 DCM_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300008543 | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-08-49 | Environmental | Open in IMG/M |
| 3300008783 | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 300m_>1.6micron | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009721 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_174_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009723 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_233_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009748 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_210_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011273 | Marine microbial communities from the Deep Pacific Ocean - MP1492 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011277 | Marine microbial communities from the Southern Atlantic ocean - KN S14 170_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011283 | Marine microbial communities from the Southern Atlantic ocean - KN S14 170_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011284 | Marine microbial communities from the Southern Atlantic ocean - KN S15 AAIW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011287 | Marine microbial communities from the Southern Atlantic ocean - KN S15 O2min_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011289 | Marine microbial communities from the Southern Atlantic ocean - KN S19 O2min_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011290 | Marine microbial communities from the Southern Atlantic ocean - KN S15 NADW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011291 | Marine microbial communities from the Southern Atlantic ocean - KN S19 250_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011292 | Marine microbial communities from the Southern Atlantic ocean - KN S15 250m_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011293 | Marine microbial communities from the Southern Atlantic ocean - KN S14 O2min_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011294 | Marine microbial communities from the Southern Atlantic ocean - KN S19 250_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011295 | Marine microbial communities from the Southern Atlantic ocean - KN S17 O2min_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011296 | Marine microbial communities from the Southern Atlantic ocean - KN S17 250_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011300 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011301 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 O2min_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011303 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011304 | Marine microbial communities from the Southern Atlantic ocean - KN S17 AAIW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011306 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011307 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011312 | Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011313 | Marine microbial communities from the Southern Atlantic ocean - KN S17 Bottom_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011314 | Marine microbial communities from the Southern Atlantic ocean - KN S15 Bottom_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011317 | Marine microbial communities from the Southern Atlantic ocean - KN S17 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011318 | Marine microbial communities from the Southern Atlantic ocean - KN S19 AAIW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011319 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 250_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011320 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 250_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011321 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Bottom_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011322 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 250_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011324 | Marine microbial communities from the Southern Atlantic ocean - KN S17 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011325 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011327 | Marine microbial communities from the Southern Atlantic ocean - KN S19 NADW_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011328 | Marine microbial communities from the Southern Atlantic ocean - KN S17 250_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300021291 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021334 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021348 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029637 | Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029645 | Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030726 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030727 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_532_33.10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030729 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031340 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_322_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031378 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_319_33.10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031559 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_937_33.10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031581 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1286_33.1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032127 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032145 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_1000m_313 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032146 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_Tmax_316 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034481 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_Tmax_1102 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034679 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1000m_1099 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0008451J51688_1097711 | 3300003554 | Seawater | SAHGVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0005509_11580501 | 3300005579 | Deep Ocean | RRSVAEGSPADNATSVVAESGLKIPRREMTSKEGVDSSVL* |
| Ga0005503_10045431 | 3300006693 | Deep Ocean | SVAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0031668_11782501 | 3300006697 | Deep Ocean | KSVAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0031672_10064111 | 3300006698 | Deep Ocean | EGSPADNATSVVAESGLKIPRREMTSKEGVDSSVL* |
| Ga0031673_10387252 | 3300006711 | Deep Ocean | ALMSVAGGSPADKVTSVAEKSGLKIPGRETSSKEGVNLLVL* |
| Ga0079248_10012321 | 3300006721 | Marine | KSVAGGSPADETASVVEESGLKTPRRETASKEEVYSPAL* |
| Ga0079248_14226942 | 3300006721 | Marine | KSVAGGSPADEATSVAEESGLKTPRRGAASKEDVYSPAL* |
| Ga0031666_10056942 | 3300006727 | Deep Ocean | CRRSAPKSVAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0079231_10135612 | 3300006729 | Marine | AEGSPADNAALVVEESGLQTPRGEMASKEGVDSSVL* |
| Ga0079231_10280671 | 3300006729 | Marine | KSVAGGSPADETASVVEESGLKTPRRGTASKEEVYSPAL* |
| Ga0079232_10267721 | 3300006732 | Marine | LMSVAEGSPADNAALVVEESGLQTPRGEMASKEGVDSSVL* |
| Ga0079255_12226171 | 3300007213 | Marine | VAGGSPADNAALVAAESGLKTPRRGTGSKEDVYSSAL* |
| Ga0079245_13155071 | 3300007336 | Marine | SVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0079241_12285921 | 3300007340 | Marine | AQKSVARGSPEDDVTLVTEEAGLKIPGRERISKEMSDSSVL* |
| Ga0102801_13950831 | 3300007612 | Marine | KSVARGSPEDDVTLVTEEAGLKIPGRERISKEMSDSSVL* |
| Ga0103607_10040331 | 3300008543 | Hydrothermal Vents | VAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0103598_105351 | 3300008783 | Ocean Water | AGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0115105_114318431 | 3300009679 | Marine | LKSVAGGSPADKATSVAAESGLKTPRRETGSKEGVYSSAL* |
| Ga0123358_109331 | 3300009721 | Marine | ALRSVARGSPEDEATSVVEEAGLKIPGREMASKEVGHSSVL* |
| Ga0123374_1240341 | 3300009723 | Marine | LRSVARGSPEDEATSVVEEAGLKIPGREMASKEVGHSSVL* |
| Ga0123370_10127891 | 3300009748 | Marine | LALRSVARGSPEDEATSVVEEAGLKIPGREMASKEVGHSSVL* |
| Ga0138352_1015081 | 3300011273 | Deep Ocean | APKSVAGGSPADDAALVAEESGLKIPRREAASEEDVYSPAL* |
| Ga0138374_1026881 | 3300011277 | Marine | LMSVAGGSPEDNVTSVTAKPGLKIPRRETSSKEGVNLLVL* |
| Ga0138374_1157811 | 3300011277 | Marine | LAWSALMSVVGGSPADKVTSVAGEAGLKIPGRETSSKEGVNLLVL* |
| Ga0138374_1198111 | 3300011277 | Marine | LRSVAGGSPADGAASVAEKSGLKTSRREMTSKEGVYSSAL* |
| Ga0138374_1229301 | 3300011277 | Marine | ALKSVAGGSPADEAALVAEESGLKTPRRGATSKEDVYSLAL* |
| Ga0138374_1279991 | 3300011277 | Marine | AKERRQGSPGDNVTSVAAEPGLETPRRETASKEDVNSSVL* |
| Ga0138375_1323891 | 3300011283 | Marine | SVAEGSPADNAALVVEESGLQTPRGEMASKEGVDSSAL* |
| Ga0138380_1145831 | 3300011284 | Marine | ARSVAGGSPGDNATSVAAESGLKTSRREASSKEGVYSSVL* |
| Ga0138380_1516311 | 3300011284 | Marine | PKSVVGGSPADNVTSVTAESGLKTPRRGTGSKEHVYSSVL* |
| Ga0138379_1023731 | 3300011287 | Marine | GVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0138379_1528911 | 3300011287 | Marine | ALKSVAGGSPADDAASVAEESGLKIPRRGAASKEEVYSPAL* |
| Ga0138396_1120741 | 3300011289 | Marine | ALMSVVGGSPADKVTSVAEKSGLKIPGRETSSKEGVNLLVL* |
| Ga0138381_1619341 | 3300011290 | Marine | APKSVAGGSPADDAALVAEESGLKIPRRGAASEEDVYSPAL* |
| Ga0138381_1677871 | 3300011290 | Marine | RSVAEGSPADNATSVVAESGLKIPRREMTSKEGVDSSVL* |
| Ga0138395_1170051 | 3300011291 | Marine | LKSVAGGSPADDAASVAEESGLKIPRRGAASKEEVYSPAL* |
| Ga0138395_1595341 | 3300011291 | Marine | AQISVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0138395_1671651 | 3300011291 | Marine | LRSVAGGSPVDGAASVAEKSGLKTSRREMTSKEGVYSSAL* |
| Ga0138377_1263482 | 3300011292 | Marine | VAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0138377_1360521 | 3300011292 | Marine | ALMSVAEGSPADNAALVVEESGLQTPRGEMASKEGVDSSAL* |
| Ga0138377_1698621 | 3300011292 | Marine | LMSVAGGSPVDEVASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0138377_1775311 | 3300011292 | Marine | AQSVAGGSPGDNAASVAAESGLKTSRREASSKEGVYSSVL* |
| Ga0138377_1974061 | 3300011292 | Marine | AQRSVAEGSPADKAASVAAESGLKIPRREMASKEGVDFSVL* |
| Ga0138376_1205061 | 3300011293 | Marine | LKSVARGSPADDATLVAEESGLKIPRREMTSKEGIDSSAL* |
| Ga0138376_1244781 | 3300011293 | Marine | PRSVAEGSPADNATSVAAEAGLKIPRREMASKEGVDSSVL* |
| Ga0138376_1811781 | 3300011293 | Marine | AQISVAGGSPADKVTSVAEESGLKIPGTETSSKEGVNSSVL* |
| Ga0138394_10704031 | 3300011294 | Marine | KERRQGSPGDNVTSVAAEPGLETPRRETASKEDVNSSVL* |
| Ga0138394_10796061 | 3300011294 | Marine | RSVAEGSPADNATSVAAESGLKIPRREMASKEGVDSSVL* |
| Ga0138389_10139201 | 3300011295 | Marine | ALKSVARGSPADDATLVAEESGLKIPRREMTSKEGIDSSAL* |
| Ga0138387_10354801 | 3300011296 | Marine | AQRSVAEGSPADNATSVAAKSGLKIPRREMASKEGVDSSVL* |
| Ga0138364_10454101 | 3300011300 | Marine | QKSVARGSPEDDVTLVTEEAGLKIPGRERISKEMSDSSVL* |
| Ga0138364_10520491 | 3300011300 | Marine | LMSVAEGSPADNAALVVEESGLQTPRGEMASKEGVDSSAL* |
| Ga0138360_10627502 | 3300011301 | Marine | ALMSVAGGSPVDEVASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0138360_10715571 | 3300011301 | Marine | SSRRSARKSVAEGSPGDNATSVAAEPGLKIPRREMASKEGVDSSVL* |
| Ga0138405_10192361 | 3300011303 | Marine | ALMSVARGSPEDEATSVVEEAGLKIPGREMASKEVGHSSVL* |
| Ga0138390_10025521 | 3300011304 | Marine | SCRLAPKSVAGGSPVDDATSVAEEAGLKTPRRGTGSKEDVYSPAL* |
| Ga0138390_10370961 | 3300011304 | Marine | KSVAGGSPADDAALVAEESGLKTPRRGAASEEDVYSPAL* |
| Ga0138390_10637211 | 3300011304 | Marine | ALQSVARGSPADDATLVAEESGLKIPRREMTSKEGIDSSAL* |
| Ga0138371_10890161 | 3300011306 | Marine | QKSVARGSPEDDVTLVTKEAGLKIPGRERISKEMSDSSVL* |
| Ga0138404_10871801 | 3300011307 | Marine | LMSVARGSPEDEATSVVEEAGLKIPGREMASKEVGHSSVL* |
| Ga0138349_10812401 | 3300011312 | Deep Ocean | ARMSVAGGSPEDNVTLVTAEPGLKIPRRETSSKEGVNLLVL* |
| Ga0138349_11159011 | 3300011312 | Deep Ocean | PRSVAGGSPADDAALVAEESGLKTPRREAASKEDVDSSAL* |
| Ga0138349_11222571 | 3300011312 | Deep Ocean | GGSPVDDATSVAEEAGLKTPRRGTGSKEDVYSPAL* |
| Ga0138392_10167221 | 3300011313 | Marine | PKSVAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0138392_10489891 | 3300011313 | Marine | GSPADDATLVAEESGLKIPRREMASKEGIDSSAL* |
| Ga0138392_11468851 | 3300011313 | Marine | LQSVAGGSPADDAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0138382_10542601 | 3300011314 | Marine | APKSVAGGSPADEAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0138386_11293061 | 3300011317 | Marine | LAFKGVAGGSPADNAALVAAESGLKTPRRGTGSKEDVYSSAL* |
| Ga0138397_10462461 | 3300011318 | Marine | KSVAGGSPVDDATSVAEEAGLKTPRRGTGSKEDVYSPAL* |
| Ga0138397_10949691 | 3300011318 | Marine | VARGSPADGAASVAEKSGLKTSRREMTSKEGVYSSAL* |
| Ga0138397_11182701 | 3300011318 | Marine | AKERRQGSPGDNVTSVAAEPGLETPRREMASKEGVNSSVL* |
| Ga0138366_10869781 | 3300011319 | Marine | PKSVAGGSPADEATSVAEESGLKTPRRGAASKEDVYSPAL* |
| Ga0138358_10540521 | 3300011320 | Marine | ALKSVAGGSPADDAALVAEESGLKIPRRGAASKEEVYSPAL* |
| Ga0138358_10998851 | 3300011320 | Marine | LQSVARGSPADDATLVAEESGLKIPRREMTSKEGIDSSVL* |
| Ga0138358_11301651 | 3300011320 | Marine | LMSVAEGSPADNAALVVEESRLQTPRGEMASKEGVDSSAL* |
| Ga0138358_11528651 | 3300011320 | Marine | AQSVAGGSPEDHAASVAAESGLKTSRREASSKEGVYSSVL* |
| Ga0138358_11967361 | 3300011320 | Marine | AHGVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0138361_11485921 | 3300011321 | Marine | SVAGGSPADDAASVAEESGLKIPRRGTGSKEDVYSPAL* |
| Ga0138359_10315531 | 3300011322 | Marine | SVAGGSPGDNATLVAAESGLKTSRREASSKEGVYSSVL* |
| Ga0138359_11630271 | 3300011322 | Marine | LMSVAEGSPADNAASVAEEPGLQTPRGEMASKEGVDSSAL* |
| Ga0138385_10330141 | 3300011324 | Marine | PLLAFKGVAGGSPADNAALVAAESGLKTPRRGTGSKEDVYSSAL* |
| Ga0138385_11134401 | 3300011324 | Marine | TSVAGGSPADKVTSVTEKAGLKIPGRETSSKEGVNSSVL* |
| Ga0138365_10449681 | 3300011325 | Marine | RTSVAGGSPADNVTSVTEKAGLKIPGRETSSKEGVNSSVL* |
| Ga0138365_12438811 | 3300011325 | Marine | FKGVAGGSPADNAALVAAESGLKTPRRGTGSKEDVYSSAL* |
| Ga0138398_12352131 | 3300011327 | Marine | SAPKSVVGGSPADNVTSVTAESGLKTPRRGTGSKEHVYSSVL* |
| Ga0138388_10032731 | 3300011328 | Marine | APKSVVGGSPADNVTSVTAESGLKTPRRGTGSKEHGYSSVL* |
| Ga0138388_10100991 | 3300011328 | Marine | VKERRQGSPGDNVTLVAAEPGLETPRRETASKEDVNSSVL* |
| Ga0138388_10686171 | 3300011328 | Marine | AGGSPGDNATSVAAESGLKTSRREASSKEGVYSSVL* |
| Ga0138388_11995341 | 3300011328 | Marine | RSVAGGSPADDAALVAEESGLKTPRRGPASEEDVYSPAL* |
| Ga0138388_12399191 | 3300011328 | Marine | SVAEGSPADNAALVVEEPGLQTPRGEMASKEGVDSSAL* |
| Ga0138388_12609741 | 3300011328 | Marine | QRSVAEGSPADNATSVAAKSGLKIPRREMASKEGVDSSVL* |
| Ga0206694_10098691 | 3300021291 | Seawater | PKSVVGGSPADKVTSVAAEPGLKIPRRVTISKEGVYSSVL |
| Ga0206694_10365081 | 3300021291 | Seawater | VAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL |
| Ga0206694_10433871 | 3300021291 | Seawater | LRSVAGGSPVDGAASVAEKSGLKTSRREMTSKEGVYSSAL |
| Ga0206694_10864821 | 3300021291 | Seawater | AHGVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL |
| Ga0206696_15287881 | 3300021334 | Seawater | AWSVAGGSPGDNATSVAAESGLKTSRREASSKEGVYSSVL |
| Ga0206696_15378721 | 3300021334 | Seawater | PKSVVGGSPADNVTSVTAESGLKTPRRGTGSKEHVYSSVL |
| Ga0206691_11773851 | 3300021342 | Seawater | ARSVAGGSPGDNATSVAAESGLKTSRREASSKEGVYSSVL |
| Ga0206691_18961261 | 3300021342 | Seawater | PRSVAEGSPADNATSVAAEAGLKIPRREMASKEGVDSSVL |
| Ga0206688_101451111 | 3300021345 | Seawater | SAHGVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL |
| Ga0206688_105706032 | 3300021345 | Seawater | ALRSVAGGSPVDGAASVAEKSGLKTSRREMTSKEGVYSSAL |
| Ga0206688_108343832 | 3300021345 | Seawater | ALMSVVGGSPADKVTSVAGESGLKIPGRETSSKEGVNLLVL |
| Ga0206695_12603801 | 3300021348 | Seawater | ALKSVAGGSPADEAALVAEESGLKTPRRGATSKEDVYSPAL |
| Ga0206695_13061921 | 3300021348 | Seawater | ALMSVAGGSPGDNVTSVTAEPGLKIPGRETSSKEGVNLLVL |
| Ga0206693_17847911 | 3300021353 | Seawater | APKSVVGGSPADKVTSVAAEPGLKIPRRVTISKEGVYSSVL |
| Ga0206690_104156851 | 3300021355 | Seawater | AKERRQGSPGDNVTSVAAEPGLETPRRETASKEDVNSSVL |
| Ga0206689_100164551 | 3300021359 | Seawater | HGVAGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL |
| Ga0206689_108760731 | 3300021359 | Seawater | SALKSVAGGSPADEAALVAEESGLKTPRRGATSKEDVYSPAL |
| Ga0257131_1029391 | 3300029637 | Marine | APKSVAGGSPADDAALVAEESGLKIPRREAASEEDVYSPAL |
| Ga0257130_1010771 | 3300029645 | Marine | KSVAGGSPADDAALVAEESGLKIPRRGAASEEDVYSPAL |
| Ga0308126_10197142 | 3300030726 | Marine | VAGGSPADEATSVVEESGLKIPRRGTGSKEDVYSPAL |
| Ga0308140_10243742 | 3300030727 | Marine | ALKSVAGGSPADEATSVVEESGLKIPRRGTGSKEDVYSPAL |
| Ga0308140_10248691 | 3300030727 | Marine | ALKSVAGGSPEDDAALVAEETGLKIPRRGTASEEDAYSPAL |
| Ga0308131_10417302 | 3300030729 | Marine | LKSVAGGSPADEATSVVEESGLKIPRRGTGSKEDVYSPAL |
| Ga0308146_10274181 | 3300031340 | Marine | ALKSVAGGSPEDDAALVAEETGLKIPRRVTTSKEGVYSSVL |
| Ga0308145_10217391 | 3300031378 | Marine | LEFRRGSSDPLKSVAGGSPEDDAALVAEETGLKIPRRGTASEEDAYSPAL |
| Ga0308135_10308852 | 3300031559 | Marine | RSALKSVAGGSPADEATSVVEESGLKIPRRGTGSKEDVYSPAL |
| Ga0308125_10291092 | 3300031581 | Marine | KSVAGGSPADEATSVVEESGLKIPRRGTGSKEDVYSPAL |
| Ga0315305_10634001 | 3300032127 | Marine | ALMSVVGGSPADKVTSVAEKSGLKIPGRETSSKEGVNLLVL |
| Ga0315305_10662111 | 3300032127 | Marine | APKSVAGGSPADEAASVAEESGLKIPRRETGSKEDVYSPAL |
| Ga0315305_11163662 | 3300032127 | Marine | AQISVAGGSPADKVTSVAEESGLKIPGRETISKEGVNSSVL |
| Ga0315304_10616271 | 3300032145 | Marine | PKSVAGGSPADEAASVAEESGLKIPRRETGSKEDVYSPAL |
| Ga0315304_10648931 | 3300032145 | Marine | ALMSVAGGSPADKVTSVAEKSGLKIPGRETSSKEGVNLLVL |
| Ga0315304_10651281 | 3300032145 | Marine | PKSVAGGSPADDAALVAEESGLKIPRREAASEEDVYSPAL |
| Ga0315303_10404101 | 3300032146 | Marine | ALRSVARGSPADGAASVAEKSGLKTSRREMTSKEGVYSSAL |
| Ga0315303_10408961 | 3300032146 | Marine | AKERRQGSPGDNVTSVAAEPGLETPRREMASKEGVNSSVL |
| Ga0315299_10973_630_752 | 3300034481 | Marine | PKSVAGGSPGDDAASVAEESGLKTPRRGAASEEDVYSPAL |
| Ga0315300_036366_9_128 | 3300034679 | Marine | MSVAGGSPADKVTSVAEKSGLKIPGRETSSKEGVNLLVL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |