| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008783 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117950 | Gp0126187 | Ga0103598 |
| Sample Name | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 300m_>1.6micron |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Georgia Institute of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 2016272 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine oxygen minimum zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 18.9 | Long. (o) | -104.5 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000942 | Metagenome / Metatranscriptome | 826 | Y |
| F042865 | Metagenome / Metatranscriptome | 157 | N |
| F063612 | Metatranscriptome | 129 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103598_10279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| Ga0103598_10535 | Not Available | 690 | Open in IMG/M |
| Ga0103598_10906 | Not Available | 572 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103598_10279 | Ga0103598_102792 | F042865 | MSLRVPDYETFLAADDFNKRIWWTFMQSVVNDLPLNGNVAPENTVRANKSCLYVESTGGAAVLWFNPNGNGSSTGWIVK* |
| Ga0103598_10535 | Ga0103598_105351 | F063612 | AGGSPADKVTSVAEESGLKIPGRETSSKEGVNSSVL* |
| Ga0103598_10906 | Ga0103598_109061 | F000942 | MAQGYLQEQSQRNQDYVSSAWEFAQEQGDANMKLWNELQPDSYSIEDIKKKAAELYEFVEKK* |
| ⦗Top⦘ |