| Basic Information | |
|---|---|
| Family ID | F016972 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 243 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LTPLTDEIPVVNLYLTINDSYRVSFGAKTSRYGPHELGYRRATKTFTK |
| Number of Associated Samples | 218 |
| Number of Associated Scaffolds | 243 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 1.65 % |
| % of genes near scaffold ends (potentially truncated) | 73.25 % |
| % of genes from short scaffolds (< 2000 bps) | 92.59 % |
| Associated GOLD sequencing projects | 208 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (60.905 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.811 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.041 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.790 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.05% Coil/Unstructured: 78.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 243 Family Scaffolds |
|---|---|---|
| PF03175 | DNA_pol_B_2 | 1.23 |
| PF00499 | Oxidored_q3 | 0.82 |
| PF00119 | ATP-synt_A | 0.82 |
| PF12899 | Glyco_hydro_100 | 0.41 |
| PF00032 | Cytochrom_B_C | 0.41 |
| PF00361 | Proton_antipo_M | 0.41 |
| PF00146 | NADHdh | 0.41 |
| COG ID | Name | Functional Category | % Frequency in 243 Family Scaffolds |
|---|---|---|---|
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.82 |
| COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 0.82 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.41 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.41 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.91 % |
| Unclassified | root | N/A | 39.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000305|bgg_mtDRAFT_1032536 | Not Available | 1638 | Open in IMG/M |
| 3300000305|bgg_mtDRAFT_1038076 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Meruliaceae → Phlebia → Phlebia radiata | 1640 | Open in IMG/M |
| 3300000902|JGI12144J12865_101742 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 753 | Open in IMG/M |
| 3300001085|JGI12187J13240_100613 | Not Available | 697 | Open in IMG/M |
| 3300001087|JGI12677J13195_1005943 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 941 | Open in IMG/M |
| 3300001088|JGI12665J13242_100341 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 941 | Open in IMG/M |
| 3300001150|JGI12672J13324_102835 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 637 | Open in IMG/M |
| 3300001867|JGI12627J18819_10165536 | Not Available | 898 | Open in IMG/M |
| 3300002651|Ga0005458J37252_105615 | Not Available | 664 | Open in IMG/M |
| 3300002653|Ga0005486J37273_104817 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1455 | Open in IMG/M |
| 3300002654|Ga0005464J37254_102448 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1839 | Open in IMG/M |
| 3300002655|Ga0005476J37264_103290 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1289 | Open in IMG/M |
| 3300002655|Ga0005476J37264_104710 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 1998 | Open in IMG/M |
| 3300002655|Ga0005476J37264_104773 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 1692 | Open in IMG/M |
| 3300002655|Ga0005476J37264_105108 | Not Available | 752 | Open in IMG/M |
| 3300002659|Ga0005474J37262_107937 | Not Available | 603 | Open in IMG/M |
| 3300002662|Ga0005456J37224_102970 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1675 | Open in IMG/M |
| 3300002673|Ga0005480J37268_102911 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1772 | Open in IMG/M |
| 3300002886|JGI25612J43240_1030585 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 789 | Open in IMG/M |
| 3300003161|Ga0006765J45826_102116 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1854 | Open in IMG/M |
| 3300003170|JGI25865J46337_100597 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 700 | Open in IMG/M |
| 3300003300|Ga0006758J48902_1016623 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1658 | Open in IMG/M |
| 3300003322|rootL2_10117872 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 5758 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10039397 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1755 | Open in IMG/M |
| 3300003557|Ga0007432J51704_101690 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1878 | Open in IMG/M |
| 3300003570|Ga0007418J51697_1048723 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 562 | Open in IMG/M |
| 3300003575|Ga0007409J51694_1033325 | Not Available | 601 | Open in IMG/M |
| 3300003576|Ga0007413J51701_1058411 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 565 | Open in IMG/M |
| 3300003735|Ga0006780_1053403 | Not Available | 501 | Open in IMG/M |
| 3300004092|Ga0062389_102501722 | Not Available | 685 | Open in IMG/M |
| 3300004121|Ga0058882_1619843 | Not Available | 693 | Open in IMG/M |
| 3300004134|Ga0058906_1003058 | Not Available | 1985 | Open in IMG/M |
| 3300004134|Ga0058906_1343005 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1802 | Open in IMG/M |
| 3300004136|Ga0058889_1433484 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 1642 | Open in IMG/M |
| 3300004477|Ga0068971_1476337 | Not Available | 501 | Open in IMG/M |
| 3300004599|Ga0068933_1261303 | Not Available | 631 | Open in IMG/M |
| 3300004619|Ga0068953_1394583 | Not Available | 539 | Open in IMG/M |
| 3300004631|Ga0058899_11385414 | Not Available | 644 | Open in IMG/M |
| 3300004635|Ga0062388_100324644 | Not Available | 1298 | Open in IMG/M |
| 3300004785|Ga0058858_1426767 | Not Available | 680 | Open in IMG/M |
| 3300004798|Ga0058859_10072897 | Not Available | 1900 | Open in IMG/M |
| 3300004803|Ga0058862_10189756 | Not Available | 1701 | Open in IMG/M |
| 3300005167|Ga0066672_10348436 | Not Available | 967 | Open in IMG/M |
| 3300005335|Ga0070666_11525516 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Polyporaceae → Ganoderma → unclassified Ganoderma → Ganoderma sp. TQC-2021a | 500 | Open in IMG/M |
| 3300005337|Ga0070682_101068206 | Not Available | 674 | Open in IMG/M |
| 3300005457|Ga0070662_100119241 | Not Available | 2020 | Open in IMG/M |
| 3300005542|Ga0070732_10015417 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 4257 | Open in IMG/M |
| 3300005602|Ga0070762_10028871 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 2950 | Open in IMG/M |
| 3300005610|Ga0070763_10026682 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 2606 | Open in IMG/M |
| 3300005650|Ga0075038_10049308 | Not Available | 580 | Open in IMG/M |
| 3300005983|Ga0081540_1140258 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 971 | Open in IMG/M |
| 3300006426|Ga0075037_1095489 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1159 | Open in IMG/M |
| 3300006800|Ga0066660_10000008 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 39257 | Open in IMG/M |
| 3300006918|Ga0079216_10454685 | Not Available | 827 | Open in IMG/M |
| 3300006937|Ga0081243_1135317 | Not Available | 666 | Open in IMG/M |
| 3300010061|Ga0127462_108742 | Not Available | 589 | Open in IMG/M |
| 3300010069|Ga0127467_136191 | Not Available | 643 | Open in IMG/M |
| 3300010074|Ga0127439_144856 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 565 | Open in IMG/M |
| 3300010082|Ga0127469_155394 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 553 | Open in IMG/M |
| 3300010092|Ga0127468_1066596 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 681 | Open in IMG/M |
| 3300010098|Ga0127463_1023390 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 516 | Open in IMG/M |
| 3300010104|Ga0127446_1133041 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 520 | Open in IMG/M |
| 3300010118|Ga0127465_1104590 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 713 | Open in IMG/M |
| 3300010118|Ga0127465_1129365 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 505 | Open in IMG/M |
| 3300010123|Ga0127479_1093877 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 575 | Open in IMG/M |
| 3300010137|Ga0126323_1077061 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 715 | Open in IMG/M |
| 3300010145|Ga0126321_1131006 | Not Available | 520 | Open in IMG/M |
| 3300010152|Ga0126318_10238331 | Not Available | 610 | Open in IMG/M |
| 3300010864|Ga0126357_1010738 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 629 | Open in IMG/M |
| 3300010864|Ga0126357_1112235 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 852 | Open in IMG/M |
| 3300010867|Ga0126347_1566331 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 743 | Open in IMG/M |
| 3300010876|Ga0126361_10384824 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 801 | Open in IMG/M |
| 3300010876|Ga0126361_10489527 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 717 | Open in IMG/M |
| 3300011068|Ga0138599_1063267 | Not Available | 528 | Open in IMG/M |
| 3300011074|Ga0138559_1153870 | Not Available | 519 | Open in IMG/M |
| 3300011083|Ga0138560_1020980 | Not Available | 532 | Open in IMG/M |
| 3300011087|Ga0138570_1097664 | Not Available | 568 | Open in IMG/M |
| 3300011088|Ga0138576_1263980 | Not Available | 503 | Open in IMG/M |
| 3300011110|Ga0138578_1195531 | Not Available | 659 | Open in IMG/M |
| 3300011120|Ga0150983_15310298 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 619 | Open in IMG/M |
| 3300011120|Ga0150983_16432490 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 676 | Open in IMG/M |
| 3300011332|Ga0126317_11009234 | Not Available | 562 | Open in IMG/M |
| 3300011333|Ga0127502_10351848 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 568 | Open in IMG/M |
| 3300011397|Ga0137444_1000409 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 4478 | Open in IMG/M |
| 3300012038|Ga0137431_1074538 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 940 | Open in IMG/M |
| 3300012225|Ga0137434_1002120 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1696 | Open in IMG/M |
| 3300012376|Ga0134032_1119746 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 598 | Open in IMG/M |
| 3300012393|Ga0134052_1202965 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 646 | Open in IMG/M |
| 3300012395|Ga0134044_1118092 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 528 | Open in IMG/M |
| 3300012582|Ga0137358_10000012 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 50181 | Open in IMG/M |
| 3300012918|Ga0137396_11187132 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 539 | Open in IMG/M |
| 3300012923|Ga0137359_10003995 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 12034 | Open in IMG/M |
| 3300012927|Ga0137416_10176949 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Polyporales incertae sedis → Spongipellis → Spongipellis spumea | 1694 | Open in IMG/M |
| 3300013052|Ga0154014_115786 | Not Available | 701 | Open in IMG/M |
| 3300014871|Ga0180095_1033354 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 869 | Open in IMG/M |
| 3300019159|Ga0184574_102375 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 721 | Open in IMG/M |
| 3300019165|Ga0184589_125858 | Not Available | 885 | Open in IMG/M |
| 3300019167|Ga0184571_104188 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 602 | Open in IMG/M |
| 3300019170|Ga0184570_103259 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 533 | Open in IMG/M |
| 3300019187|Ga0184584_131164 | Not Available | 663 | Open in IMG/M |
| 3300019189|Ga0184585_138404 | Not Available | 664 | Open in IMG/M |
| 3300019189|Ga0184585_142922 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 699 | Open in IMG/M |
| 3300019192|Ga0184603_135605 | Not Available | 655 | Open in IMG/M |
| 3300019194|Ga0184586_142720 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 710 | Open in IMG/M |
| 3300019208|Ga0180110_1232294 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 529 | Open in IMG/M |
| 3300019212|Ga0180106_1160243 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 582 | Open in IMG/M |
| 3300019228|Ga0180119_1406273 | Not Available | 689 | Open in IMG/M |
| 3300019275|Ga0187798_1308583 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 662 | Open in IMG/M |
| 3300019279|Ga0184642_1338330 | Not Available | 656 | Open in IMG/M |
| 3300020034|Ga0193753_10011643 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 5557 | Open in IMG/M |
| 3300020064|Ga0180107_1082856 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 595 | Open in IMG/M |
| 3300020065|Ga0180113_1322828 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 650 | Open in IMG/M |
| 3300020066|Ga0180108_1210894 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 597 | Open in IMG/M |
| 3300020069|Ga0197907_10742682 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 572 | Open in IMG/M |
| 3300020070|Ga0206356_10205591 | Not Available | 583 | Open in IMG/M |
| 3300020076|Ga0206355_1255773 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 559 | Open in IMG/M |
| 3300020078|Ga0206352_10295982 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 630 | Open in IMG/M |
| 3300020080|Ga0206350_11443321 | Not Available | 637 | Open in IMG/M |
| 3300020081|Ga0206354_11202773 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 555 | Open in IMG/M |
| 3300021151|Ga0179584_1274344 | Not Available | 672 | Open in IMG/M |
| 3300021259|Ga0179581_108641 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 691 | Open in IMG/M |
| 3300021307|Ga0179585_1108823 | Not Available | 690 | Open in IMG/M |
| 3300021404|Ga0210389_10397737 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1083 | Open in IMG/M |
| 3300021407|Ga0210383_10037054 | Not Available | 4069 | Open in IMG/M |
| 3300021976|Ga0193742_1001080 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 16953 | Open in IMG/M |
| 3300022499|Ga0242641_1017031 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 707 | Open in IMG/M |
| 3300022500|Ga0242643_100566 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 1806 | Open in IMG/M |
| 3300022504|Ga0242642_1030327 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 779 | Open in IMG/M |
| 3300022507|Ga0222729_1043180 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 606 | Open in IMG/M |
| 3300022508|Ga0222728_1066810 | Not Available | 632 | Open in IMG/M |
| 3300022508|Ga0222728_1080884 | Not Available | 590 | Open in IMG/M |
| 3300022508|Ga0222728_1083259 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 584 | Open in IMG/M |
| 3300022512|Ga0242676_1036156 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 575 | Open in IMG/M |
| 3300022522|Ga0242659_1040839 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 792 | Open in IMG/M |
| 3300022522|Ga0242659_1051600 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 728 | Open in IMG/M |
| 3300022523|Ga0242663_1079627 | Not Available | 624 | Open in IMG/M |
| 3300022527|Ga0242664_1003888 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1780 | Open in IMG/M |
| 3300022530|Ga0242658_1008252 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1609 | Open in IMG/M |
| 3300022530|Ga0242658_1105242 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 681 | Open in IMG/M |
| 3300022530|Ga0242658_1136589 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 621 | Open in IMG/M |
| 3300022530|Ga0242658_1153843 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 595 | Open in IMG/M |
| 3300022531|Ga0242660_1082298 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 760 | Open in IMG/M |
| 3300022531|Ga0242660_1138768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 627 | Open in IMG/M |
| 3300022532|Ga0242655_10140343 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 700 | Open in IMG/M |
| 3300022533|Ga0242662_10332938 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 514 | Open in IMG/M |
| 3300022709|Ga0222756_1032433 | Not Available | 724 | Open in IMG/M |
| 3300022712|Ga0242653_1088124 | Not Available | 554 | Open in IMG/M |
| 3300022713|Ga0242677_1072185 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 544 | Open in IMG/M |
| 3300022715|Ga0242678_1030436 | Not Available | 708 | Open in IMG/M |
| 3300022717|Ga0242661_1058989 | Not Available | 733 | Open in IMG/M |
| 3300022721|Ga0242666_1122843 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 617 | Open in IMG/M |
| 3300022724|Ga0242665_10180342 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 685 | Open in IMG/M |
| 3300022724|Ga0242665_10209776 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 646 | Open in IMG/M |
| 3300022726|Ga0242654_10230477 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 656 | Open in IMG/M |
| 3300022726|Ga0242654_10230653 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 656 | Open in IMG/M |
| 3300022911|Ga0247783_1000027 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 46144 | Open in IMG/M |
| 3300023042|Ga0233340_1002998 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1334 | Open in IMG/M |
| 3300023539|Ga0247555_102755 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 594 | Open in IMG/M |
| 3300023541|Ga0247544_101009 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 682 | Open in IMG/M |
| 3300023542|Ga0247540_100957 | Not Available | 829 | Open in IMG/M |
| 3300023562|Ga0247516_118316 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 601 | Open in IMG/M |
| 3300023662|Ga0247545_102684 | Not Available | 673 | Open in IMG/M |
| 3300023668|Ga0247525_100644 | Not Available | 2778 | Open in IMG/M |
| 3300023680|Ga0247528_110132 | Not Available | 668 | Open in IMG/M |
| 3300023708|Ga0228709_1102750 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 580 | Open in IMG/M |
| 3300024330|Ga0137417_1194584 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales | 6199 | Open in IMG/M |
| 3300026515|Ga0257158_1091694 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 595 | Open in IMG/M |
| 3300027164|Ga0208994_1045183 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 656 | Open in IMG/M |
| 3300027573|Ga0208454_1003426 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 4939 | Open in IMG/M |
| 3300027587|Ga0209220_1133562 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 645 | Open in IMG/M |
| 3300027855|Ga0209693_10385858 | Not Available | 677 | Open in IMG/M |
| 3300028134|Ga0256411_1198239 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 636 | Open in IMG/M |
| 3300029644|Ga0206083_102603 | Not Available | 553 | Open in IMG/M |
| 3300030528|Ga0210277_10296984 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 612 | Open in IMG/M |
| 3300030568|Ga0257206_1116773 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 567 | Open in IMG/M |
| 3300030587|Ga0257209_1134949 | Not Available | 502 | Open in IMG/M |
| 3300030730|Ga0307482_1071187 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 895 | Open in IMG/M |
| 3300030778|Ga0075398_10093957 | Not Available | 689 | Open in IMG/M |
| 3300030815|Ga0265746_1033704 | Not Available | 668 | Open in IMG/M |
| 3300030829|Ga0308203_1093446 | Not Available | 508 | Open in IMG/M |
| 3300030832|Ga0265752_103681 | Not Available | 691 | Open in IMG/M |
| 3300030833|Ga0265736_103039 | Not Available | 617 | Open in IMG/M |
| 3300030834|Ga0265738_102223 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 741 | Open in IMG/M |
| 3300030841|Ga0075384_10008743 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 521 | Open in IMG/M |
| 3300030844|Ga0075377_10071314 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 557 | Open in IMG/M |
| 3300030863|Ga0265766_1009507 | Not Available | 681 | Open in IMG/M |
| 3300030873|Ga0265751_106630 | Not Available | 687 | Open in IMG/M |
| 3300030882|Ga0265764_105753 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 701 | Open in IMG/M |
| 3300030897|Ga0315889_121595 | Not Available | 587 | Open in IMG/M |
| 3300030902|Ga0308202_1082125 | Not Available | 641 | Open in IMG/M |
| 3300030917|Ga0075382_10097051 | All Organisms → cellular organisms → Eukaryota | 697 | Open in IMG/M |
| 3300030920|Ga0102762_1033452 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 1784 | Open in IMG/M |
| 3300030932|Ga0074001_11217343 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 622 | Open in IMG/M |
| 3300030938|Ga0138299_10666022 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 624 | Open in IMG/M |
| 3300030967|Ga0075399_10057975 | Not Available | 642 | Open in IMG/M |
| 3300030970|Ga0075381_10126429 | Not Available | 619 | Open in IMG/M |
| 3300030970|Ga0075381_10137104 | Not Available | 846 | Open in IMG/M |
| 3300030996|Ga0074004_10976435 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 648 | Open in IMG/M |
| 3300031015|Ga0138298_1277054 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 727 | Open in IMG/M |
| 3300031021|Ga0102765_11314954 | Not Available | 558 | Open in IMG/M |
| 3300031024|Ga0265724_101795 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 688 | Open in IMG/M |
| 3300031040|Ga0265754_1011139 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 718 | Open in IMG/M |
| 3300031094|Ga0308199_1075319 | Not Available | 705 | Open in IMG/M |
| 3300031114|Ga0308187_10237066 | Not Available | 657 | Open in IMG/M |
| 3300031123|Ga0308195_1071745 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 538 | Open in IMG/M |
| 3300031128|Ga0170823_14812064 | Not Available | 546 | Open in IMG/M |
| 3300031231|Ga0170824_111808564 | Not Available | 1471 | Open in IMG/M |
| 3300031231|Ga0170824_117304484 | Not Available | 632 | Open in IMG/M |
| 3300031231|Ga0170824_117455267 | Not Available | 655 | Open in IMG/M |
| 3300031421|Ga0308194_10216210 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 627 | Open in IMG/M |
| 3300031446|Ga0170820_10101621 | Not Available | 721 | Open in IMG/M |
| 3300031446|Ga0170820_16682310 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales | 1488 | Open in IMG/M |
| 3300031456|Ga0307513_10001111 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 38947 | Open in IMG/M |
| 3300031474|Ga0170818_100810910 | Not Available | 535 | Open in IMG/M |
| 3300031591|Ga0310116_113924 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 717 | Open in IMG/M |
| 3300031614|Ga0310103_128022 | Not Available | 687 | Open in IMG/M |
| 3300031633|Ga0310108_115224 | Not Available | 764 | Open in IMG/M |
| 3300031636|Ga0310113_121690 | Not Available | 657 | Open in IMG/M |
| 3300031664|Ga0310118_117977 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 578 | Open in IMG/M |
| 3300031667|Ga0310111_124845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 715 | Open in IMG/M |
| 3300031686|Ga0310119_122670 | Not Available | 673 | Open in IMG/M |
| 3300031791|Ga0316034_100366 | All Organisms → cellular organisms → Eukaryota | 1658 | Open in IMG/M |
| 3300031791|Ga0316034_103705 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 705 | Open in IMG/M |
| 3300031808|Ga0316037_109259 | Not Available | 668 | Open in IMG/M |
| 3300031808|Ga0316037_112776 | Not Available | 594 | Open in IMG/M |
| 3300031809|Ga0316048_103912 | Not Available | 714 | Open in IMG/M |
| 3300031817|Ga0316046_104275 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 770 | Open in IMG/M |
| 3300031827|Ga0247532_102641 | Not Available | 641 | Open in IMG/M |
| 3300031866|Ga0316049_110418 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 672 | Open in IMG/M |
| 3300031869|Ga0316030_110070 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 545 | Open in IMG/M |
| 3300031872|Ga0316033_107656 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 641 | Open in IMG/M |
| 3300031874|Ga0316047_104612 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 700 | Open in IMG/M |
| 3300031891|Ga0316039_112560 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 588 | Open in IMG/M |
| 3300031956|Ga0316032_104364 | Not Available | 675 | Open in IMG/M |
| 3300032589|Ga0214500_1130557 | Not Available | 716 | Open in IMG/M |
| 3300032590|Ga0214489_1057505 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 578 | Open in IMG/M |
| 3300032593|Ga0321338_1381518 | Not Available | 503 | Open in IMG/M |
| 3300032812|Ga0314745_1121574 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Ceratobasidiaceae → Rhizoctonia → Rhizoctonia solani | 532 | Open in IMG/M |
| 3300032914|Ga0314750_1137138 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 570 | Open in IMG/M |
| 3300032916|Ga0314734_1096868 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 582 | Open in IMG/M |
| 3300032959|Ga0314738_1095805 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 516 | Open in IMG/M |
| 3300033525|Ga0314758_1174746 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Fibroporiaceae → Fibroporia → Fibroporia radiculosa | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.35% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.29% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 3.29% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.88% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.06% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.06% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.06% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.23% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.41% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.41% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.41% |
| Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 0.41% |
| Upper Troposphere | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere | 0.41% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.41% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.41% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.41% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.41% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.82% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.82% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000305 | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly | Host-Associated | Open in IMG/M |
| 3300000902 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 | Environmental | Open in IMG/M |
| 3300001085 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 | Environmental | Open in IMG/M |
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300001088 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 | Environmental | Open in IMG/M |
| 3300001150 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002651 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF107 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002653 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF135 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002654 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF113 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002655 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF125 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002659 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF123 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002662 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF105 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002673 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF129 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003170 | Upper troposphere microbial communities - SDPR-005 | Environmental | Open in IMG/M |
| 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003557 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Bulk_48 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003570 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003576 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_29 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004132 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF240 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004134 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004599 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004619 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006937 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010069 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010074 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010137 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300019159 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019167 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019170 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019187 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019194 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021259 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_2_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300023042 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-241 | Environmental | Open in IMG/M |
| 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023541 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023542 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023662 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029644 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030568 | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-1 (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030587 | Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-LITTER (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030778 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030832 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030833 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030834 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030873 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030897 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T34 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030920 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030932 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030938 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030970 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030996 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031021 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031024 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031664 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031791 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031808 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031809 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031817 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031827 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031869 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031872 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031874 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032914 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| bgg_mtDRAFT_10325361 | 3300000305 | Host-Associated | VRLIPLTDEIPVVNLYLTIDDLYIFSLGAKTSRYGPYELGYRRATITLTI* |
| bgg_mtDRAFT_10380762 | 3300000305 | Host-Associated | VRLTSLTDEIPVFNLYLKINEIDRISFGAKTSRYGPHVLGYRRATITFTK* |
| JGI12144J12865_1017421 | 3300000902 | Forest Soil | VRLTPLTDEIPVVTLNLTINEFYIFSFGAKTSRYGPHELGYRRATKTFTK* |
| JGI12187J13240_1006131 | 3300001085 | Forest Soil | VRLNPLTDAIPVVNLYLTIHEFDKISFGAKTSRYGPYGLGY |
| JGI12677J13195_10059431 | 3300001087 | Forest Soil | YLTINDSYRVSFGAKTSRYGPYELGYRRATKTFTK* |
| JGI12665J13242_1003412 | 3300001088 | Forest Soil | PVVNLYLTINVTDRVSFGAKTSRYGPHELGYKRATKTFTK* |
| JGI12672J13324_1028351 | 3300001150 | Forest Soil | LTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| JGI12627J18819_101655363 | 3300001867 | Forest Soil | VRLTPLTDEILIVNLYLTINDTDRVSFRAKTSRYGPHELGYRRAT |
| Ga0005458J37252_1056151 | 3300002651 | Forest Soil | VRLNPLTDAIPVVNLYLTIYEFDKISFGAKTSRYGPYGLGYRRATITLTK* |
| Ga0005486J37273_1048173 | 3300002653 | Forest Soil | VRLTPLTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKIFTK* |
| Ga0005464J37254_1024482 | 3300002654 | Forest Soil | VRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPYELGYRRATKSFTK* |
| Ga0005476J37264_1032902 | 3300002655 | Forest Soil | VRLTPLTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0005476J37264_1047103 | 3300002655 | Forest Soil | VRLTPLTDEIPVVNLYLTINEFYIFSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0005476J37264_1047731 | 3300002655 | Forest Soil | VRLNPLTDAIPIVNLILNNENIDKIFVGAKTSHYGPNELGYRRAIKTLTK* |
| Ga0005476J37264_1051082 | 3300002655 | Forest Soil | VRLTPLTDEIPAINLYLIVNDIYKISLGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0005474J37262_1079371 | 3300002659 | Forest Soil | EIPAVYFYYTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0005456J37224_1029701 | 3300002662 | Forest Soil | MVRLTPLTDEIPVVNFYLTINEIYRVSFGAKTSRYGPHELGYRRAT* |
| Ga0005480J37268_1029113 | 3300002673 | Forest Soil | VRLTPLTDEILIVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK* |
| JGI25612J43240_10305852 | 3300002886 | Grasslands Soil | VRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPHELGYKRATKTFTK* |
| Ga0006765J45826_1021163 | 3300003161 | Avena Fatua Rhizosphere | VRLTPLTDEIPIVNLYLTIHSIDIILFGAKTSRYGPYELGYRRATKTFTK* |
| JGI25865J46337_1005971 | 3300003170 | Upper Troposphere | LYFYIYLTIYDSYRVSFGAKTSRYGPYALGYRRATKTFTI* |
| Ga0006758J48902_10166232 | 3300003300 | Avena Fatua Rhizosphere | VRLTPQTDEIPVVNLYLTIYDIYKISFGAKTSLYGPHELGYRRATKTFTK* |
| rootL2_101178725 | 3300003322 | Sugarcane Root And Bulk Soil | MAVSVRIVKVRLIPLTDEIPVVNLYLTIYDLYIFSFGAKTSRYGPHELGYRRATITLTK* |
| JGIcombinedJ51221_100393973 | 3300003505 | Forest Soil | VRLIPLTDEIPVVNLYLTMNGSDRVPFGAKTSRYGPHEMGYRRAT* |
| Ga0007432J51704_1016903 | 3300003557 | Avena Fatua Rhizosphere | VRLTPLTDAIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0007418J51697_10487231 | 3300003570 | Avena Fatua Rhizosphere | VVNLYLTIYESYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0007409J51694_10333251 | 3300003575 | Avena Fatua Rhizosphere | IPAVNFDLTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0007413J51701_10584111 | 3300003576 | Avena Fatua Rhizosphere | AIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK*SKTVSFLNERK* |
| Ga0006780_10534031 | 3300003735 | Avena Fatua Rhizosphere | VRLTPLTDEIPAVNFYLTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0062389_1025017221 | 3300004092 | Bog Forest Soil | MAVSVRVVEVWLNPLTDKIPVVNLYLTINDTDRASFGAKTSRYGPHELGYRRATKTLTK* |
| Ga0058882_16198433 | 3300004121 | Forest Soil | QTDEIPIVNFYLAINGPIQVPFWGKTSRYGPHELGYRRATKAFTK* |
| Ga0058902_12392531 | 3300004132 | Forest Soil | MAVVSPYFEKLLNPQTDEIPFINLYLIFYDSYKVSFGAKTSRYGPHDLGNRRATRTFTK* |
| Ga0058906_10030581 | 3300004134 | Forest Soil | VRLTPLTDEIPAVNLYLTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0058906_13430051 | 3300004134 | Forest Soil | VRLTPLTDEILVVNLYLTINGTDRVSFRAKTSRYGPYELGYRRATKTFTK* |
| Ga0058889_14334841 | 3300004136 | Forest Soil | VRLNPLTDAIPIVNLILNNENIDKVFVGAKTSPYGPNELGYRRAIKTLTK* |
| Ga0068971_14763371 | 3300004477 | Peatlands Soil | LIPLTDEIPIVNLYLTMYKSYKLLFGAKTSRYDPYELGYRRATKTFTK* |
| Ga0068933_12613031 | 3300004599 | Peatlands Soil | PVVILYLTIYDNDKLSFGAKTSRYGPYELGYRRATITFTK* |
| Ga0068953_13945831 | 3300004619 | Peatlands Soil | IPVVNLFLTINSSDRVLFGAKTSRYGPHDLGYRRATITFTK* |
| Ga0058899_113854141 | 3300004631 | Forest Soil | TDEIPAVNLYLTVNDIYKISFGAKTSRYGPHELGYRRATKAFTK* |
| Ga0062388_1003246441 | 3300004635 | Bog Forest Soil | VRLNPLTDEIPIVNLYLTINSIDIILFGAKASRYGPYELGYRRATKTFTK* |
| Ga0058858_14267671 | 3300004785 | Host-Associated | TDEIPAVNFYLTVNDIYKISFGAKTSRYGPHELGYRRATSIFTK* |
| Ga0058859_100728973 | 3300004798 | Host-Associated | VRLTPLTDEIPAVNFYLTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0058862_101897561 | 3300004803 | Host-Associated | VRLTPLTDEIPVVNLYLTIYDFYIFSFGAKTSLYGPHELGYRRATKTFTK* |
| Ga0066672_103484361 | 3300005167 | Soil | MAVSVRAVEVWLNPLTDKIPVVNLYLTINDTDRASFGAKTSRYCPHELSYRRATKTLTK* |
| Ga0070666_115255162 | 3300005335 | Switchgrass Rhizosphere | VRLTPLTDEIPAVNFYLTVNDFYKISFGAKTSRYGPYGLG* |
| Ga0070682_1010682061 | 3300005337 | Corn Rhizosphere | VRLIPLTDEIPVVNLYLTIYDLYIFSFGTKTSRYGPYELGYRRATITLTI* |
| Ga0070662_1001192412 | 3300005457 | Corn Rhizosphere | VRLTPLTDEIPAVNFYLTVNDIYKISFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0070732_1001541710 | 3300005542 | Surface Soil | VRLTPLTDEILVVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK* |
| Ga0070762_100288713 | 3300005602 | Soil | VRLTPLTDEILVVNLYLTINVTDRVSFRAKTSRYGPHELGYRRATKTFTK* |
| Ga0070763_100266823 | 3300005610 | Soil | VRLTPLTDAIPVVNLYLTINDFDIFSFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0075038_100493081 | 3300005650 | Permafrost Soil | LLAYAKYYNFYLTMNKFDKGLFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0081540_11402582 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VRLTPLTDAILIINFNLIINSTDRVLFGAKTSRYGPYELGYRRATKIFTK* |
| Ga0075037_10954892 | 3300006426 | Permafrost Soil | VRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPNELGYRRATKTFTK* |
| Ga0066660_1000000839 | 3300006800 | Soil | MAVSVRAVEVWLNPLTDKIPVVNLYLTINDTDRASFGAKTSRYGPHELGYRRATKTLTK* |
| Ga0079216_104546851 | 3300006918 | Agricultural Soil | VRLIPLTDEIPVVNLYLTIYDLYTFSFGTKTSRYGPYELGYRRATITFTI* |
| Ga0081243_11353171 | 3300006937 | Tropical Rainforest Soil | VRLTPLTDEIPVVNLYLTINDFYIFSFGAKTSLYGPHELGYRRATKTFTK* |
| Ga0127462_1087421 | 3300010061 | Grasslands Soil | QSVL*EVRLTPLTDEIPVVNLYLTIYDSYRVSFGAKTSRYGPHELGYRRATKNFYKVKLYF* |
| Ga0127467_1361911 | 3300010069 | Grasslands Soil | PLTDEIPAVYFYYTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0127439_1448561 | 3300010074 | Grasslands Soil | FNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0127469_1553941 | 3300010082 | Grasslands Soil | VRLTPLTDEIPVVNLYLTIYDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0127468_10665961 | 3300010092 | Grasslands Soil | LTPLTDEIPVVNLYLTIYDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0127463_10233901 | 3300010098 | Grasslands Soil | VNLYLTIHSIDIILFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0127446_11330411 | 3300010104 | Grasslands Soil | LTPLTDEIPIVNLYLTIHSIDIILFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0127465_11045901 | 3300010118 | Grasslands Soil | TDEIPIVNLYLTIHSIDIILFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0127465_11293651 | 3300010118 | Grasslands Soil | TDEIPVVNLYLTIYDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0127479_10938771 | 3300010123 | Grasslands Soil | LTDAIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0126323_10770611 | 3300010137 | Soil | VRLTPLTDEILVVNLYLTINGTDRVSFGAKTSRYGPYELGYRRAAKAFTK* |
| Ga0126321_11310061 | 3300010145 | Soil | PAVNFYLTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0126318_102383311 | 3300010152 | Soil | DEIPAVNFYLTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK* |
| Ga0126357_10107381 | 3300010864 | Boreal Forest Soil | AIPVVNLYLTINNIDRVLFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0126357_11122351 | 3300010864 | Boreal Forest Soil | LTDEIPVVNLYLTINDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0126347_15663311 | 3300010867 | Boreal Forest Soil | LTPLTDEIPVVNLYLTINDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0126361_103848241 | 3300010876 | Boreal Forest Soil | *EVRLTPLTDEIPVVNLYLTINDFEIFSFGAKTSRYGPHVLGYRRATNTFTK*CNTRPIS |
| Ga0126361_104895271 | 3300010876 | Boreal Forest Soil | RLTPLTDEIPVVNLYLTINDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0138599_10632671 | 3300011068 | Peatlands Soil | IPLTDEIPIVNLYLTMYKSYKLLFGAKTSRYDPYELGYRRATKTFTK* |
| Ga0138559_11538701 | 3300011074 | Peatlands Soil | LTDEIPIVNLYLTMYKSYKLLFGAKTSRYDPYELGYSRATKTFTK* |
| Ga0138560_10209801 | 3300011083 | Peatlands Soil | VRLIPPTDEIPVVNLFLTINSSDRVLFGAKTSRYGPHDLGYRRATITFTK* |
| Ga0138570_10976641 | 3300011087 | Peatlands Soil | LTIYDNDKLSFGAKTSRYGPYELGYRRATITFTN* |
| Ga0138576_12639801 | 3300011088 | Peatlands Soil | PIVNLYLTMYKSYKLLFGAKTSRYDPYELGYRRATKTFTK* |
| Ga0138578_11955311 | 3300011110 | Peatlands Soil | LTINSSDRVLFGAKTSRYGPHDLGYRRATITFTK* |
| Ga0150983_153102981 | 3300011120 | Forest Soil | NLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK* |
| Ga0150983_164324901 | 3300011120 | Forest Soil | TDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0126317_110092341 | 3300011332 | Soil | TDEIPVINLYLIIYGSDIDHFGAKTSRYGPNELGYRRAM* |
| Ga0127502_103518481 | 3300011333 | Soil | LTPLTDAIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0137444_10004093 | 3300011397 | Soil | VRLTPLTDEIPVVNLYLTINGSDRVSFGVKTSRYGPYELGYKRATKTFTK* |
| Ga0137431_10745381 | 3300012038 | Soil | VRLTPLTDEIPVVNLYLTINDADRVSFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0137434_10021201 | 3300012225 | Soil | VRLTPLTDEIPVVNLYLTIDDTDRVSFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0134032_11197461 | 3300012376 | Grasslands Soil | VVNFYLTTNEIDKVSFGAKTSPYGPHELGYRRATKAFTK* |
| Ga0134052_12029651 | 3300012393 | Grasslands Soil | VVNLYLTIYDIYKISFGAKTSLYGPHELGYRRATKTFTK* |
| Ga0134044_11180921 | 3300012395 | Grasslands Soil | EIPVVNLYLTIYDSYRVSFGAKTSRYGPHELGYRRATKTFTK* |
| Ga0137358_1000001247 | 3300012582 | Vadose Zone Soil | VRLTPLTDEIPVVNLYLTIDDADRVSFGAKTSRYGPYELGYRRATKTFTM* |
| Ga0137396_111871321 | 3300012918 | Vadose Zone Soil | YLTINGTDRVSFRAKTSRYGPYELGYRRATKTFTK* |
| Ga0137359_100039951 | 3300012923 | Vadose Zone Soil | VRLTPLTDEIPVVNLYLTIDDADRVLFGAKTSRYGPYELGYRRATKTFTM* |
| Ga0137416_101769491 | 3300012927 | Vadose Zone Soil | VRLTPLTDEIPVVNLYLTINDADRVSFGAKTSRYGPYELGYKRATKTFTK* |
| Ga0154014_1157861 | 3300013052 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLTPLTDEIPVVNLYLTIYDFYIFSFGAKTSLYGPHELGYRRA |
| Ga0180095_10333541 | 3300014871 | Soil | VRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPYELGYRRATKTFTK* |
| Ga0184574_1023751 | 3300019159 | Soil | RLTPLTDEIPVVNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0184589_1258581 | 3300019165 | Soil | LTDAIPVVNLFLTIYEFYIFSFGAKTSRYDPHELGYRRATKTFTK |
| Ga0184571_1041881 | 3300019167 | Soil | LTPLTDEIPVVNLYLTINGSYRGSFGAKTSRYGPYELGYRRATKTFTKXC |
| Ga0184570_1032591 | 3300019170 | Soil | IPVVNFYLTINEIYRVSFGAKTSRYGPHELGYRRAT |
| Ga0184584_1311641 | 3300019187 | Soil | VVNLFLTIYEFYIFSFGAKTSRYDPHELGYRRATKTFTK |
| Ga0184585_1384041 | 3300019189 | Soil | DAIPVVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKIFTKXCKTKPL |
| Ga0184585_1429221 | 3300019189 | Soil | AIPVVNLYLTINEFYIFSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0184603_1356051 | 3300019192 | Soil | VNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKIFTK |
| Ga0184586_1427201 | 3300019194 | Soil | PLTDEIPVVNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0180110_12322941 | 3300019208 | Groundwater Sediment | INGTDRVSFGAKTSRYGPYELGYRRATKTFTKXCKIVPLNFNMAICVSK |
| Ga0180106_11602431 | 3300019212 | Groundwater Sediment | TDEIPVVNLYLTINVTDRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0180119_14062731 | 3300019228 | Groundwater Sediment | LYLTINVTDRVSFGAKTSRYGPHELGYRRAIITFTMXRKTLAR |
| Ga0187798_13085831 | 3300019275 | Peatland | XKVRLTPLTDEIPFVNLNLTFYGSDRVPFGAKTSHYGPHELGYRRATKTFTKXRNTCLD |
| Ga0184642_13383301 | 3300019279 | Groundwater Sediment | PAVNFYLTVNDFYKRSFGAKTSRYGPHGLGYRRATKTFTIXCKTRPIF |
| Ga0193753_1001164312 | 3300020034 | Soil | VRLTPLTDEIPVVNLYLTINDADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0180107_10828561 | 3300020064 | Groundwater Sediment | PLTDEIPVVNLYLTIYGTDRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0180113_13228281 | 3300020065 | Groundwater Sediment | VRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0180108_12108941 | 3300020066 | Groundwater Sediment | LTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0197907_107426821 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LTPLTDAIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK |
| Ga0206356_102055911 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | FYLTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK |
| Ga0206355_12557731 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | DAIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK |
| Ga0206352_102959821 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | LYLTIYDSYRVSFGAKTSRYGPHELGYRRATKAFTK |
| Ga0206350_114433211 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | XEVRLTPLTDEIPAVNFYLTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTKXCKTRPLF |
| Ga0206354_112027731 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | AIPVFNLYLKIYGNDRFPFGAKTSRYGPYELGYRRATKTFTK |
| Ga0179584_12743441 | 3300021151 | Vadose Zone Soil | IPVVNLYLTINDTDRASFGAKTSRYGPHELGYRRATKTLTKXSDTVPLIFF |
| Ga0179581_1086411 | 3300021259 | Vadose Zone Soil | EIPVFNLYLITYDSDRVSFGAKTSRYGSHELGYRRAAKTFTK |
| Ga0179585_11088231 | 3300021307 | Vadose Zone Soil | XEVWLNPLTDKIPVVNLYLTINDTDRASFGAKTSRYGPHELGYRRATKTLTKXSNTVP |
| Ga0210389_103977373 | 3300021404 | Soil | PVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0210383_100370544 | 3300021407 | Soil | VRLTPLTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0193742_10010807 | 3300021976 | Soil | VRLTPLTDEIPVVNLYLTINDADRVSFGAKTSRYGPHELGYKRATKTFTK |
| Ga0242641_10170311 | 3300022499 | Soil | DEILIVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK |
| Ga0242643_1005661 | 3300022500 | Soil | VRLNPLTDAIPIVNLILNNENIDKIFVGAKTSHYGPNELGYRRAIKTLTK |
| Ga0242642_10303271 | 3300022504 | Soil | KVRLNPLTDKIPVVNLYLTINGLDKIPFGAKTSRYDPHGLGYRRATKTFTK |
| Ga0222729_10431801 | 3300022507 | Soil | VRLTPLTDEILIVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK |
| Ga0222728_10668101 | 3300022508 | Soil | NLYLTINEFYIFSFGAKTSRYDPHELGYRRATKTFTK |
| Ga0222728_10808841 | 3300022508 | Soil | PLTDEIPAVNFYLTVNDFYKISFGAKTSRYGPYGLGYRRATKTFTK |
| Ga0222728_10832591 | 3300022508 | Soil | EILIVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK |
| Ga0242676_10361561 | 3300022512 | Soil | LTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0242659_10408391 | 3300022522 | Soil | XKVRLNPLTDKIPVVNLYLTINGLDKIPFGAKTSRYDPHGLGYRRATKTFTKXCKTVPARHF |
| Ga0242659_10516001 | 3300022522 | Soil | TDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0242663_10796271 | 3300022523 | Soil | EILIVNLYLTINDTDRVSFRTKTSRYGPHELGYRRATKTFTMXCKTLA |
| Ga0242664_10038881 | 3300022527 | Soil | MRLTPLTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0242658_10082521 | 3300022530 | Soil | VRLTPLTDEIPVVNLYLTIYDADRVSFGAKTSRYGPYELGYKRATKTFTK |
| Ga0242658_11052421 | 3300022530 | Soil | EIPVVNLHLTINDFYIFSFGAKTSRYGPHELGYRRATKTFTKXRKTGPFYYLQIANS |
| Ga0242658_11365892 | 3300022530 | Soil | FITYLTIYDSYKVSFGAKTSLYGPYELGYRRATKTFTK |
| Ga0242658_11538431 | 3300022530 | Soil | VRLTPLTDEIPVVNLNLTINVTDRVSFGAKTSRYGPHELGYKRATKTFTK |
| Ga0242660_10822981 | 3300022531 | Soil | EIPVVNLHLTINDFYIFSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0242660_11387681 | 3300022531 | Soil | LTINDSYRVSFGAKTSRYGPYELGYRRATKTFTKXC |
| Ga0242655_101403431 | 3300022532 | Soil | RLTPLTDEIPAINLYLIVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK |
| Ga0242662_103329381 | 3300022533 | Soil | VNLYLTINGLDKIPFGAKTSRYDPHGLGYRRATKTFTK |
| Ga0222756_10324331 | 3300022709 | Soil | PLTDAIPVVNLYLTIYEFYIFSFGAKTSRYDPNGLGYKRAAKTFTKXSKIVPLK |
| Ga0242653_10881242 | 3300022712 | Soil | LYLTIYEFDIFSFGAKTSRYDPHELGYRRATKTFTK |
| Ga0242677_10721851 | 3300022713 | Soil | EVRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0242678_10304361 | 3300022715 | Soil | AIPVVNLYLTIYEFYIFSFGAKTSRYDPNGLGYKRAAKTFTKXSKIVPLK |
| Ga0242661_10589891 | 3300022717 | Soil | VRLTPLTDAIPVVNLYLTIYEFYIFSFGAKTSRYDPNGLGYKRAAKTFTKXSKIVPLK |
| Ga0242666_11228431 | 3300022721 | Soil | GCRQSVSSEVRLTPQTDEIPVVNLYLTINGADRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0242665_101803421 | 3300022724 | Soil | EIPAINLYLIVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK |
| Ga0242665_102097761 | 3300022724 | Soil | ILYIIYLIIYDSYRVSFGAKTSRYGPYELGYRRATKTFTKXC |
| Ga0242654_102304771 | 3300022726 | Soil | LTPLTDEIPAVNFYLTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTKXCKTRSIF |
| Ga0242654_102306531 | 3300022726 | Soil | EVRLTPLTDEILVVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTKXCETVP |
| Ga0247783_100002738 | 3300022911 | Plant Litter | VRLNPLTDAIPVVNLYLTTNDPEKVSFGAKTSPYGPYGLGYRRAAKTFTK |
| Ga0233340_10029981 | 3300023042 | Leaf Litter | NIYLTINGLDKIPFGAKTSRYDPYELGYRRATKTFTK |
| Ga0247555_1027551 | 3300023539 | Soil | LYVITYLTIYDSYRVSFGAKTSLYGPYELGYRRATKTFTKXC |
| Ga0247544_1010091 | 3300023541 | Soil | VNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0247540_1009571 | 3300023542 | Soil | VRLTPLTDAIPVVNLYLTINEFYIFSFGAKTSRYDPHELGYRRATKTFTKXSKIXPLL |
| Ga0247516_1183161 | 3300023562 | Soil | EIPVVNFYLTINESYRGSFGAKTSRYGPHELGYRRATKTFTKXCKIVPALIGLYL |
| Ga0247545_1026841 | 3300023662 | Soil | PLTDAIPVVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKIFTK |
| Ga0247525_1006442 | 3300023668 | Soil | VRLTPLTDAIPVVNLYLTIYEFYIFSFGTKTSRYDPYEL |
| Ga0247528_1101321 | 3300023680 | Soil | TYAIPVVNLYLTIYEFYLFSCGTKTSRYDPYELGYRRATKIFTKXCKTKPL |
| Ga0228709_11027501 | 3300023708 | Freshwater | LTPLTDEILIVNLHLTIYGIYRISFGAKTSRYGPYELGNRRATITFTKXRKTKPLF |
| Ga0137417_11945845 | 3300024330 | Vadose Zone Soil | VRLTPLTDEIPVVNLYLTINDADRVSFGAKTSRYGPYELGYKRATKTFTK |
| Ga0257158_10916941 | 3300026515 | Soil | VRLTPLTDEIPVVNLYLTINVTDRVSFGAKTSRYGPHELGYKRATKTFTK |
| Ga0208994_10451831 | 3300027164 | Forest Soil | VRLIPLTDEIPVFNLYLITNDSDRVSFGAKTSRYGSHELGYRRAAKTFTK |
| Ga0208454_10034261 | 3300027573 | Soil | TDEILVVNLYLTIYGIYKISFRAKTSRYGPHELGYRRATKTFTK |
| Ga0209220_11335622 | 3300027587 | Forest Soil | IIYLTINDSYRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0209693_103858582 | 3300027855 | Soil | IPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0256411_11982392 | 3300028134 | Seawater | FRLIPLTNAIPVVNFYLTINGSDRGSFGAKTSRYGPHVLGYRRATKTFTK |
| Ga0206083_1026031 | 3300029644 | Soil | PLTDEIPVVNLYLTIYDLYTFSFGTKTSRYGPYELGYRRATITFTIXR |
| Ga0210277_102969841 | 3300030528 | Soil | MQNLNNFYLTMNDSDKVSFGAKTSRYGPHGLGYRRATKTFTK |
| Ga0257206_11167731 | 3300030568 | Host-Associated | PIINLYLIIYGTDRVSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0257209_11349491 | 3300030587 | Host-Associated | VNLYLTINGSYRGSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0307482_10711872 | 3300030730 | Hardwood Forest Soil | VRLTSLTDEIPTVNLYLTINDSYRVSFGAKTSRYGPHALGYRRATKTFTKXCKTYQLNF |
| Ga0075398_100939571 | 3300030778 | Soil | VRLTPLTDEIPVVNLYLTINGTDRVSFGAKTSRYGPYELGYRR |
| Ga0265746_10337041 | 3300030815 | Soil | AIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0308203_10934461 | 3300030829 | Soil | EIPVVNLYLTIDDLYIFSLGAKTSRYGPYELGYRRATITLTI |
| Ga0265752_1036811 | 3300030832 | Soil | VRLTPLTDAIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0265736_1030391 | 3300030833 | Soil | DEIPAVNFYLTVNDFYKISFGAKTSRYGPHGLGYRRATKTFTK |
| Ga0265738_1022231 | 3300030834 | Soil | AIPVINLYLIIYDTDIVSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0075384_100087431 | 3300030841 | Soil | VVNLYLTINVTDRVSFGAKTSRYGPHELGYKRATKTFTK |
| Ga0075377_100713141 | 3300030844 | Soil | FTYLTINDSYRVSFGAKTSRYGPYELGYRRATKTFTKXC |
| Ga0265766_10095071 | 3300030863 | Soil | TDAIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0265751_1066301 | 3300030873 | Soil | LTPLTDAIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0265764_1057531 | 3300030882 | Soil | DEILVVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK |
| Ga0315889_1215951 | 3300030897 | Plant Litter | LTPLTDEIPVINLYLIIHGLYIFPFGAKTSRYGPHELGYRRAIKS |
| Ga0308202_10821251 | 3300030902 | Soil | LTPLTDEIPAVNLYLTVNDIYKISFGAKTSRYGPHGLGYRRATKTFTK |
| Ga0075382_100970511 | 3300030917 | Soil | TYLTINDSYRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0102762_10334521 | 3300030920 | Soil | VRLTPLTDEIPVVNLYLTIDDTDRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0074001_112173431 | 3300030932 | Soil | RLTPLTDEILVVNLYLTINDTDRVSFRAKTSRYGPHELGNRRATKTFTK |
| Ga0138299_106660221 | 3300030938 | Soil | LLLIKNIFYLYFITYLTIYDSYKVSFGAKTSLYGPYELGYRRATKTFTK |
| Ga0075399_100579751 | 3300030967 | Soil | IPVVNLYLTIYEFYIFSFGTKTSRYDPHELGYRCATKIFTK |
| Ga0075381_101264291 | 3300030970 | Soil | VRLTSLTDVIPIFNLYLKIYEFDRFSFGAKTSRYGSNVVG |
| Ga0075381_101371041 | 3300030970 | Soil | VRLTSLTDVIPIFNLYLKIYEFDRFSFGAKTSRYGSNVVGYRRATITLTK |
| Ga0074004_109764351 | 3300030996 | Soil | LTDEIPIVNLYLTFYGFKKIPFGAKTSRYGPYELGYRRATKTFTK |
| Ga0138298_12770541 | 3300031015 | Soil | VRLTPLTDAIPVVNLYLTIYDSDRVSFGAKTSRYGPNGLGYRRAT |
| Ga0102765_113149541 | 3300031021 | Soil | RLTPLTDEIPVVNLYLTINDFYIISFGAKTSLYGPHELGYRRATKTFTKXCKTSLGIANH |
| Ga0265724_1017951 | 3300031024 | Soil | NLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK |
| Ga0265754_10111391 | 3300031040 | Soil | LTDAIPVINLYLIIYDTDIVSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0308199_10753191 | 3300031094 | Soil | XEVRLTPLTDEIPAVNFYLTVNDFYKRSFGAKTSRYGPHGLGYRRATKTFTNXSKTRQI |
| Ga0308187_102370661 | 3300031114 | Soil | PAVNFYLTVNDFYKISFGAKTSRYGPYGLGYRRATKTLTN |
| Ga0308195_10717451 | 3300031123 | Soil | VNLYLTIYGIDRISFGAKTSRYGPYVLGYRRATKTFTKXCKTVPYK |
| Ga0170823_148120641 | 3300031128 | Forest Soil | VVSLYLTIDDTDRVSFGAKTSRYGPYELGYRRATKTFTI |
| Ga0170824_1118085641 | 3300031231 | Forest Soil | VRLTPLTDEIPVVNLYLTINVTDRVLFGAKTSRYGPNELGYKRATKTFTK |
| Ga0170824_1173044841 | 3300031231 | Forest Soil | VRLNPLTDAIPVVNLYLTIHEFDKISFGAKTSRYGPYGLGYRRATITLTK |
| Ga0170824_1174552671 | 3300031231 | Forest Soil | VRLTPLTDEIPVVSLYLTIDDTDRVSFGAKTSRYGPYELGYRRATKTFTI |
| Ga0308194_102162102 | 3300031421 | Soil | VRLTPLTDEIPIVNLYLTIHSIDIILFGAKTSRYGPYELGYRRATKTFTK |
| Ga0170820_101016212 | 3300031446 | Forest Soil | LYLTIDDTDRVSFGAKTSRYGPYELGYKRAIKTFTK |
| Ga0170820_166823101 | 3300031446 | Forest Soil | YLTINDSYRVSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0307513_1000111143 | 3300031456 | Ectomycorrhiza | VRLTPLTDEIPVVNLYLTINDTDRVLFGAKTSRYGPYELGYKRATKTFTK |
| Ga0170818_1008109101 | 3300031474 | Forest Soil | PLTDAIPVVNLYLTIYEFDKISFGAKTSRYGPYGLGYRRATITLTK |
| Ga0310116_1139241 | 3300031591 | Soil | LTPLTDEIPVVNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0310103_1280221 | 3300031614 | Soil | PLTDAIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0310108_1152241 | 3300031633 | Soil | EVRLTPLTDAIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0310113_1216901 | 3300031636 | Soil | LYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0310118_1179771 | 3300031664 | Soil | TDEIPVVNLYLTIYGIDRVSFGAKTSRYGPYELGYRRATKNFTKXCKIVP |
| Ga0310111_1248451 | 3300031667 | Soil | VRLTPLTDEIPVVNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0310119_1226701 | 3300031686 | Soil | DAIPIVNLYLTIYEFYIFSFGTKTSRYDPYELGYRRATKTFTK |
| Ga0316034_1003661 | 3300031791 | Soil | TDAIPVVNLYLTINEFYIFSFGAKTSRYDPHELGYRRATKTFTK |
| Ga0316034_1037051 | 3300031791 | Soil | EILVVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATKTFTK |
| Ga0316037_1092591 | 3300031808 | Soil | LTDEIPVVNLYLTINGSYRGSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0316037_1127761 | 3300031808 | Soil | RLNPLTDAIPVVNLYLTIYDIDKISFGAKTSPYGPHELGYQRATKTFTK |
| Ga0316048_1039121 | 3300031809 | Soil | VRLNPLTDAIPVVNLYLTINDTEKVSFGAKTSRYGPYGLGYRRATRTFTKXSKTENT |
| Ga0316046_1042751 | 3300031817 | Soil | PVVNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0247532_1026411 | 3300031827 | Soil | VRLTPLTDEIPVVNLYLTINGSYRGSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0316049_1104181 | 3300031866 | Soil | PVVNLYLTISEFYIFSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0316030_1100701 | 3300031869 | Soil | MVRLTPLTDEIPVVNFYLTINEIYRVSFGAKTSRYGPHELGYRRAT |
| Ga0316033_1076561 | 3300031872 | Soil | PLTDEIPVVNLYLTINGSYRGSFGAKTSRYGPYELGYRRATKTFTK |
| Ga0316047_1046121 | 3300031874 | Soil | EIPVVNLYLTINDSYRDSFGAKTSRYGPHELGYRRATKTFTK |
| Ga0316039_1125601 | 3300031891 | Soil | VWLTPLTDEIPVVNFYLTIYDSYXVSFGAKTSRYGPHELGYRRAT |
| Ga0316032_1043641 | 3300031956 | Soil | VRLTPLTDEILVVNLYLTINDTDRVSFRAKTSRYGPHELGYRRATITFTK |
| Ga0214500_11305571 | 3300032589 | Switchgrass Phyllosphere | VRLNPLTDAIPVVNLYLTTNDPEKVSFGAKTSPYGPYGLGYRRAARTLTK |
| Ga0214489_10575051 | 3300032590 | Switchgrass Phyllosphere | DKIPVIHLYXIINGYDRLPFGAKTSRYGPHELGYRRATKTFTKXSKTVF |
| Ga0321338_13815182 | 3300032593 | Switchgrass Phyllosphere | LNPLTDAIPVVNLYLTTNDPEKVSFGAKTSPYGPYGLGYRRAARTLTK |
| Ga0314745_11215741 | 3300032812 | Switchgrass Phyllosphere | IPVVNLYLTINDSDRVSFGAKTSRYGPNGLGYRRATKTFTMXRKTLLGFMPNSRKV |
| Ga0314750_11371381 | 3300032914 | Switchgrass Phyllosphere | LLNIRLIPLTNEIPVINLYLITNESDRDSAGAKTSRYGPHVLGYRRATKTFTK |
| Ga0314734_10968681 | 3300032916 | Switchgrass Phyllosphere | LTPLTDALPVFNLNLKIYGNDRFPCGAKTSRYGPHELGYRRATKTFTK |
| Ga0314738_10958051 | 3300032959 | Switchgrass Phyllosphere | YLITNGYDRFPFGAKTSRYGPYELGYRRATKTFTK |
| Ga0314758_11747461 | 3300033525 | Switchgrass Phyllosphere | LNPLTDEIPVINLYLIINGSDRVPFGAKTSRYGPHELGYRRATKTFTK |
| ⦗Top⦘ |