| Basic Information | |
|---|---|
| Family ID | F060965 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAADPLD |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 62.88 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin (11.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.303 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (28.788 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01176 | eIF-1a | 43.18 |
| PF00344 | SecY | 24.24 |
| PF00416 | Ribosomal_S13 | 12.88 |
| PF00411 | Ribosomal_S11 | 7.58 |
| PF00828 | Ribosomal_L27A | 3.03 |
| PF03118 | RNA_pol_A_CTD | 1.52 |
| PF07650 | KH_2 | 1.52 |
| PF00861 | Ribosomal_L18p | 0.76 |
| PF01258 | zf-dskA_traR | 0.76 |
| PF03091 | CutA1 | 0.76 |
| PF13412 | HTH_24 | 0.76 |
| PF00410 | Ribosomal_S8 | 0.76 |
| PF00327 | Ribosomal_L30 | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 43.18 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 24.24 |
| COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 12.88 |
| COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 7.58 |
| COG1727 | Ribosomal protein L18E | Translation, ribosomal structure and biogenesis [J] | 3.03 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 1.52 |
| COG0096 | Ribosomal protein S8 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.76 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.76 |
| COG1841 | Ribosomal protein L30/L7E | Translation, ribosomal structure and biogenesis [J] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.15 % |
| Unclassified | root | N/A | 9.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000269|M3P_1064861 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 545 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_104008746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 831 | Open in IMG/M |
| 3300001850|RCM37_1037371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 522 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100689749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 899 | Open in IMG/M |
| 3300002705|JGI25156J39149_1006307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444 | 3258 | Open in IMG/M |
| 3300002705|JGI25156J39149_1007023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444 | 3011 | Open in IMG/M |
| 3300002737|JGI25162J39368_1002211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444 | 8009 | Open in IMG/M |
| 3300002738|JGI25154J39366_1003757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444 | 3015 | Open in IMG/M |
| 3300002864|Ga0006764J43180_108330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 839 | Open in IMG/M |
| 3300003544|Ga0007417J51691_1122053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 653 | Open in IMG/M |
| 3300004613|Ga0068937_1291474 | Not Available | 524 | Open in IMG/M |
| 3300004790|Ga0007758_11337321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 950 | Open in IMG/M |
| 3300005179|Ga0066684_10991711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 543 | Open in IMG/M |
| 3300005416|Ga0068880_1389865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 2078 | Open in IMG/M |
| 3300005420|Ga0068879_1055880 | Not Available | 519 | Open in IMG/M |
| 3300005457|Ga0070662_101486077 | Not Available | 584 | Open in IMG/M |
| 3300005630|Ga0068834_100137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 747 | Open in IMG/M |
| 3300005640|Ga0075035_1017760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1346 | Open in IMG/M |
| 3300005640|Ga0075035_1054871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 900 | Open in IMG/M |
| 3300005640|Ga0075035_1096117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 1209 | Open in IMG/M |
| 3300005640|Ga0075035_1108292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2255 | Open in IMG/M |
| 3300005644|Ga0075036_1011182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 645 | Open in IMG/M |
| 3300005646|Ga0075040_1091386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 540 | Open in IMG/M |
| 3300005646|Ga0075040_1129392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2230 | Open in IMG/M |
| 3300005646|Ga0075040_1129441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 816 | Open in IMG/M |
| 3300005805|Ga0079957_1312800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 702 | Open in IMG/M |
| 3300005980|Ga0066798_10188355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 564 | Open in IMG/M |
| 3300006086|Ga0075019_10093777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 1719 | Open in IMG/M |
| 3300006353|Ga0075370_10836337 | Not Available | 562 | Open in IMG/M |
| 3300006423|Ga0075039_1006555 | Not Available | 503 | Open in IMG/M |
| 3300006426|Ga0075037_1020692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 812 | Open in IMG/M |
| 3300006426|Ga0075037_1062067 | Not Available | 514 | Open in IMG/M |
| 3300006800|Ga0066660_10441585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1085 | Open in IMG/M |
| 3300006938|Ga0081245_1471015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 621 | Open in IMG/M |
| 3300007058|Ga0104043_1098429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 723 | Open in IMG/M |
| 3300007192|Ga0103268_1073729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 853 | Open in IMG/M |
| 3300007265|Ga0099794_10292506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 843 | Open in IMG/M |
| 3300008261|Ga0114336_1000594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 58241 | Open in IMG/M |
| 3300008264|Ga0114353_1104573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 1507 | Open in IMG/M |
| 3300009093|Ga0105240_11719977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 654 | Open in IMG/M |
| 3300009095|Ga0079224_104251308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 563 | Open in IMG/M |
| 3300009183|Ga0114974_10725660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 538 | Open in IMG/M |
| 3300009225|Ga0103851_1045839 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 725 | Open in IMG/M |
| 3300009230|Ga0103855_10061482 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009233|Ga0103856_10000971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 3697 | Open in IMG/M |
| 3300009233|Ga0103856_10032683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 893 | Open in IMG/M |
| 3300009233|Ga0103856_10043071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum seropedicae | 793 | Open in IMG/M |
| 3300009249|Ga0103862_1027132 | Not Available | 750 | Open in IMG/M |
| 3300009257|Ga0103869_10162011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 597 | Open in IMG/M |
| 3300009586|Ga0115591_1198614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1109 | Open in IMG/M |
| 3300009709|Ga0116227_10231665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 1425 | Open in IMG/M |
| 3300009787|Ga0116226_10084786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444 | 3257 | Open in IMG/M |
| 3300010370|Ga0129336_10378695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum seropedicae | 775 | Open in IMG/M |
| 3300010855|Ga0126355_1020322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 14794 | Open in IMG/M |
| 3300011119|Ga0105246_10984476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum seropedicae | 762 | Open in IMG/M |
| 3300011120|Ga0150983_15136963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 2992 | Open in IMG/M |
| 3300012212|Ga0150985_106384166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 729 | Open in IMG/M |
| 3300012235|Ga0118559_102386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 773 | Open in IMG/M |
| 3300012329|Ga0118434_101214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 862 | Open in IMG/M |
| 3300012332|Ga0118154_102191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herminiimonas → Herminiimonas arsenicoxydans | 1003 | Open in IMG/M |
| 3300012335|Ga0118040_106251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 770 | Open in IMG/M |
| 3300012463|Ga0118608_101269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 762 | Open in IMG/M |
| 3300012621|Ga0118196_105791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 794 | Open in IMG/M |
| 3300012649|Ga0118321_102284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1409 | Open in IMG/M |
| 3300012758|Ga0138285_1191632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 946 | Open in IMG/M |
| 3300012778|Ga0138269_1014798 | Not Available | 507 | Open in IMG/M |
| 3300012778|Ga0138269_1059877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 521 | Open in IMG/M |
| 3300012778|Ga0138269_1300283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herminiimonas → Herminiimonas arsenicoxydans | 2708 | Open in IMG/M |
| 3300012968|Ga0129337_1391354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1301 | Open in IMG/M |
| 3300013152|Ga0118018_104907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 794 | Open in IMG/M |
| 3300013179|Ga0118587_107046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 582 | Open in IMG/M |
| 3300013228|Ga0118155_112043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 531 | Open in IMG/M |
| 3300013246|Ga0118647_113133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 509 | Open in IMG/M |
| 3300013251|Ga0118602_116369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 766 | Open in IMG/M |
| 3300013265|Ga0118522_101368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum lusitanum | 1169 | Open in IMG/M |
| 3300013307|Ga0157372_10529153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1374 | Open in IMG/M |
| 3300013466|Ga0118449_102869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 764 | Open in IMG/M |
| 3300013652|Ga0118149_101617 | Not Available | 533 | Open in IMG/M |
| 3300015262|Ga0182007_10372393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 540 | Open in IMG/M |
| 3300016682|Ga0180044_1070328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 833 | Open in IMG/M |
| 3300016698|Ga0181503_1235180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 543 | Open in IMG/M |
| 3300016728|Ga0181500_1127382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 812 | Open in IMG/M |
| 3300018414|Ga0194135_10357258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 983 | Open in IMG/M |
| 3300018790|Ga0187842_1142005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 715 | Open in IMG/M |
| 3300019268|Ga0181514_1190672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 3562 | Open in IMG/M |
| 3300019270|Ga0181512_1348405 | Not Available | 511 | Open in IMG/M |
| 3300019871|Ga0193702_1005616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1706 | Open in IMG/M |
| 3300020074|Ga0194113_11067178 | Not Available | 535 | Open in IMG/M |
| 3300020565|Ga0208718_1100130 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 503 | Open in IMG/M |
| 3300020580|Ga0210403_10108673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herminiimonas → Herminiimonas arsenicoxydans | 2251 | Open in IMG/M |
| 3300021092|Ga0194122_10129220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1373 | Open in IMG/M |
| 3300021136|Ga0214167_1058723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 769 | Open in IMG/M |
| 3300021855|Ga0213854_1142661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 519 | Open in IMG/M |
| 3300021909|Ga0213846_1024150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 542 | Open in IMG/M |
| 3300021909|Ga0213846_1092056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1033 | Open in IMG/M |
| 3300022511|Ga0242651_1001416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1641 | Open in IMG/M |
| 3300022513|Ga0242667_1015508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 749 | Open in IMG/M |
| 3300022529|Ga0242668_1051444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 736 | Open in IMG/M |
| 3300022530|Ga0242658_1042118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 934 | Open in IMG/M |
| 3300022531|Ga0242660_1003972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 2179 | Open in IMG/M |
| 3300022532|Ga0242655_10018199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1469 | Open in IMG/M |
| 3300022716|Ga0242673_1041892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 744 | Open in IMG/M |
| 3300022751|Ga0247817_10152533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herminiimonas | 797 | Open in IMG/M |
| 3300022930|Ga0247816_10451241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 507 | Open in IMG/M |
| 3300024306|Ga0255148_1075901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 578 | Open in IMG/M |
| 3300024481|Ga0256330_1013162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1717 | Open in IMG/M |
| 3300024541|Ga0256343_1027227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1030 | Open in IMG/M |
| 3300024572|Ga0255268_1103427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 712 | Open in IMG/M |
| 3300024851|Ga0255293_1059693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 701 | Open in IMG/M |
| 3300025206|Ga0209435_100137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. CF444 | 24597 | Open in IMG/M |
| 3300025231|Ga0207427_122169 | Not Available | 565 | Open in IMG/M |
| 3300025233|Ga0209437_100081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 271072 | Open in IMG/M |
| 3300025591|Ga0208496_1111478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 579 | Open in IMG/M |
| 3300026272|Ga0209913_1000312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 45221 | Open in IMG/M |
| 3300026272|Ga0209913_1015069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 2191 | Open in IMG/M |
| 3300026571|Ga0255289_1146230 | Not Available | 531 | Open in IMG/M |
| 3300027578|Ga0255075_1058569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 686 | Open in IMG/M |
| 3300028105|Ga0255254_1048358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 860 | Open in IMG/M |
| 3300028785|Ga0302201_10266582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 690 | Open in IMG/M |
| 3300029915|Ga0311358_10764483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 699 | Open in IMG/M |
| 3300029916|Ga0302148_1181169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 595 | Open in IMG/M |
| 3300029917|Ga0311326_10576963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 543 | Open in IMG/M |
| 3300029952|Ga0311346_10170346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 2518 | Open in IMG/M |
| 3300029952|Ga0311346_10180609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 2411 | Open in IMG/M |
| 3300030506|Ga0302194_10226395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 761 | Open in IMG/M |
| 3300031086|Ga0074002_14467470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 981 | Open in IMG/M |
| 3300031112|Ga0308156_1117197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 768 | Open in IMG/M |
| 3300031521|Ga0311364_11471414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum | 673 | Open in IMG/M |
| 3300031821|Ga0318567_10659528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 594 | Open in IMG/M |
| 3300032074|Ga0308173_11147543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 725 | Open in IMG/M |
| 3300033534|Ga0314757_1062115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 896 | Open in IMG/M |
| 3300034012|Ga0334986_0191530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1150 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Human Skin | Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin | 11.36% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.58% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.06% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 5.30% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.79% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 3.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.03% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 3.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.52% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.52% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.76% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.76% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.76% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.76% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.76% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
| Enriched Soil Aggregate | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.76% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
| Ant Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut | 0.76% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.76% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.76% |
| Drosophila Neotestacea Female Adult Gut | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Drosophila Neotestacea Female Adult Gut | 0.76% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000269 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 7, Mississippi Headwaters | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Host-Associated | Open in IMG/M |
| 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Host-Associated | Open in IMG/M |
| 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Host-Associated | Open in IMG/M |
| 3300002864 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004613 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005416 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005630 | Enriched soil aggregate microbial communities from Iowa State university to study microbial drivers of carbon cycling - Hofmockel_1000072-3 ISU MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005644 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006938 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Host-Associated | Open in IMG/M |
| 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009230 | Microbial communities of water from Amazon river, Brazil - RCM8 | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009249 | Microbial communities of water from Amazon river, Brazil - RCM15 | Environmental | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010855 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012235 | Human skin bacterial and viral communities - University of Pennsylvania - MG100116 | Host-Associated | Open in IMG/M |
| 3300012329 | Human skin bacterial and viral communities - University of Pennsylvania - MG100673 | Host-Associated | Open in IMG/M |
| 3300012332 | Human skin bacterial and viral communities - University of Pennsylvania - MG100431 | Host-Associated | Open in IMG/M |
| 3300012335 | Human skin bacterial and viral communities - University of Pennsylvania - MG100308 | Host-Associated | Open in IMG/M |
| 3300012463 | Human skin bacterial and viral communities - University of Pennsylvania - MG100482 | Host-Associated | Open in IMG/M |
| 3300012621 | Human skin bacterial and viral communities - University of Pennsylvania - MG100478 | Host-Associated | Open in IMG/M |
| 3300012649 | Human skin bacterial and viral communities - University of Pennsylvania - MG100605 | Host-Associated | Open in IMG/M |
| 3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013152 | Human skin bacterial and viral communities - University of Pennsylvania - MG100285 | Host-Associated | Open in IMG/M |
| 3300013179 | Human skin bacterial and viral communities - University of Pennsylvania - MG100223 | Host-Associated | Open in IMG/M |
| 3300013228 | Human skin bacterial and viral communities - University of Pennsylvania - MG100432 | Host-Associated | Open in IMG/M |
| 3300013246 | Human skin bacterial and viral communities - University of Pennsylvania - MG100312 | Host-Associated | Open in IMG/M |
| 3300013251 | Human skin bacterial and viral communities - University of Pennsylvania - MG100310 | Host-Associated | Open in IMG/M |
| 3300013265 | Human skin bacterial and viral communities - University of Pennsylvania - MG100770 | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013466 | Human skin bacterial and viral communities - University of Pennsylvania - MG100688 | Host-Associated | Open in IMG/M |
| 3300013652 | Human skin bacterial and viral communities - University of Pennsylvania - MG100426 | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016682 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES101 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018414 | Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013 | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022751 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L212-509R-1 | Environmental | Open in IMG/M |
| 3300022930 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L209-509C-1 | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024541 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024851 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025591 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300028105 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300031086 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031112 | Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2 | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_10648611 | 3300000269 | Lotic | GILTPAIRAIRYSSINNVLTLALFMTRLGANYTNDALALDDLAVTADPLH* |
| JGIcombinedJ13530_1040087463 | 3300001213 | Wetland | NNVKLTLALFMTRFCADHTNNAFALDDFTIAADPLD* |
| RCM37_10373711 | 3300001850 | Marine Plankton | RAIRYSSINNVKLTLALLMARFGADHTNDTIALDDFAVAADPLD* |
| JGIcombinedJ26739_1006897493 | 3300002245 | Forest Soil | MRYSSINNVKLTLALFMTGLCANYTNHAFALDDLTVAADPLD* |
| JGI25156J39149_10063072 | 3300002705 | Arabidopsis Root | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAADPLD* |
| JGI25156J39149_10070235 | 3300002705 | Arabidopsis Root | MRYSSINNVKLTLALFMTRFCADHTNYAFALDDFAVAADPLD* |
| JGI25162J39368_100221117 | 3300002737 | Arabidopsis Rhizosphere | MRYSSINNVKLTLALFMTRFCADNTNNAFALDDFAVAADPLD* |
| JGI25154J39366_10037572 | 3300002738 | Arabidopsis Root | MRYSSINNVKLTLALFMTRFCADXTNYAFALDDFAVAADPLD* |
| Ga0006764J43180_1083303 | 3300002864 | Avena Fatua Rhizosphere | WWLGILTPAIRAIRYSSINNELTLALFMTWFRANNTNYALALDDLTVAANPLD* |
| Ga0007417J51691_11220533 | 3300003544 | Avena Fatua Rhizosphere | MLTPAIRAMRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAADPLD* |
| Ga0068937_12914741 | 3300004613 | Peatlands Soil | ANTINRSQADNGVLMIGDLTPAIRAIRYSSINNVKLTLALLMTRLGANYTNHALALDDLTVAADPLD* |
| Ga0007758_113373211 | 3300004790 | Freshwater Lake | MRYSSINNVKLTLALLMTRLDTNDSNNALALDDLTVAADSLY* |
| Ga0066684_109917113 | 3300005179 | Soil | TPAIRAIRYSSINNVKLTLALFMTRFGADDTNNAFALDDLAVAADPLD* |
| Ga0068880_13898654 | 3300005416 | Freshwater Lake | MRYSSINNVKLTLALLMAGLGANHANNAFALDDLAIAADPLH* |
| Ga0068879_10558802 | 3300005420 | Freshwater Lake | WLGMLTPAIRAMRYSSINNVKLTLALLMAGFGANHANNALALDDLAVAADPLH* |
| Ga0070662_1014860772 | 3300005457 | Corn Rhizosphere | TPAIRAIRYSSIDNELTLALLMAWLGTDDANNTLALDDFAVAADPLD* |
| Ga0068834_1001371 | 3300005630 | Enriched Soil Aggregate | GVLMVGDFTPAIRAIRYSSINNVLTLTLLMARLGADDTNHALALDDLAVAANPLD* |
| Ga0075035_10177602 | 3300005640 | Permafrost Soil | MRYSSINNVKLTLALFMARFCANNTNYAFALDDLTVAAEPLD* |
| Ga0075035_10548713 | 3300005640 | Permafrost Soil | IRAIRYSSINNVKLTLTLFMTRFCANNTNHAFALDDLAIAAYPLN* |
| Ga0075035_10961173 | 3300005640 | Permafrost Soil | TPAIRAMRYSSINNVKLTLALFMTRFCADNTNYAFALDDLTVAADPLD* |
| Ga0075035_11082921 | 3300005640 | Permafrost Soil | RYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAAEPLN* |
| Ga0075036_10111821 | 3300005644 | Permafrost Soil | ILTPAIRAIRYSSINNVKLTLALLMTRLCANNTNHALALDDLTVAADPLN* |
| Ga0075040_10913861 | 3300005646 | Permafrost Soil | RAIRYSSINNVKLTLALLMTRLCANNTNHALALDDLTVAANPLN* |
| Ga0075040_11293924 | 3300005646 | Permafrost Soil | TPAIRAMRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAAEPLN* |
| Ga0075040_11294413 | 3300005646 | Permafrost Soil | FTPAIRAMRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAADPLD* |
| Ga0079957_13128003 | 3300005805 | Lake | AIRAMRYSSINNVKLTLALLVARFGANHTDDAFALDDLAIAADPLY* |
| Ga0066798_101883553 | 3300005980 | Soil | GIFTPAIRAMRYSSINNVKLTLALFMTRFDANYTNHAFALDDLTVAADPLD* |
| Ga0075019_100937771 | 3300006086 | Watersheds | RAIRYSSINNVKLTLTLFMTWFDTNNSNYAFALDDLAIAANPLN* |
| Ga0075370_108363371 | 3300006353 | Populus Endosphere | MRYSSINNVKLTLALLVAGFGADHTNDAIALDDFAVAADPLD* |
| Ga0075039_10065552 | 3300006423 | Permafrost Soil | VLMVGDITPAIRAIRYSSINNVKLTLALLMTRFCADNTNYALALDDLTVAADPLN* |
| Ga0075037_10206923 | 3300006426 | Permafrost Soil | VLMVGDINPCNRAIRYSSINNVKLTLALLMARFDANNTNDALALDDLTVAADPLN* |
| Ga0075037_10620671 | 3300006426 | Permafrost Soil | ADNSVLMVGDLTPAIRAIRYSSINNVKLTLALLMTRLDTYYSNYALALDDLTVAANPLN* |
| Ga0066660_104415851 | 3300006800 | Soil | TPAIRAIRYSSKLTLTLLMTRLDADHTDHAFALDDLAVAADPLD* |
| Ga0081245_14710153 | 3300006938 | Tropical Rainforest Soil | MLTPAIRAIRYSSINNVNLTLALLMAWLGADDTNDAFALDDLTVAADPLD* |
| Ga0104043_10984292 | 3300007058 | Drosophila Neotestacea Female Adult Gut | MRYSLINNVKLTLALFMTRFGANYTNYAMALDDLTVAADPLY* |
| Ga0103268_10737293 | 3300007192 | Ant Gut | MRYSLIDNVTLTLALLVTWLATNDTNNTLALDDFAVAANPLD* |
| Ga0099794_102925062 | 3300007265 | Vadose Zone Soil | MRYSSINNVKLTLALFMTRFCADDTNHAFALDDLTVAADPLD* |
| Ga0114336_100059425 | 3300008261 | Freshwater, Plankton | MRYSSINNVKLTLALFMTRFDTDNSNDAFALDDLTIATDTLH* |
| Ga0114353_11045733 | 3300008264 | Freshwater, Plankton | MRYSSINNVKLTLALFMTWFCADNTNYAFALDDFAVAANPLN* |
| Ga0105240_117199771 | 3300009093 | Corn Rhizosphere | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDFA |
| Ga0079224_1042513081 | 3300009095 | Agricultural Soil | TPAIRAIRYSSKLTLTLLVTRLDADHTDHALALDDLAVAADPLD* |
| Ga0114974_107256603 | 3300009183 | Freshwater Lake | AIRAMRYSSINNVKLTLALLMTRLDTNDSNNALALNDLTVAADSLY* |
| Ga0103851_10458393 | 3300009225 | River Water | MRYSSINNVKLTLALLMTWFDKNHSNNAFALDDLAIAADSLY* |
| Ga0103855_100614822 | 3300009230 | River Water | MAVRPITVCWWLGMLTPAIRAIRYSSINNVKLTLALLVAGFGANHANDALALDDLAVAADPLH* |
| Ga0103856_100009716 | 3300009233 | River Water | MFTPAIRAIRYSSINNVKLTLALLVTGFGANHANDALALDDLAVAANPLH* |
| Ga0103856_100326833 | 3300009233 | River Water | MRYSSINNVKLTLALLMAGFGANHANDALALDDLAIAADPLH* |
| Ga0103856_100430712 | 3300009233 | River Water | MRYSSINNVKLTLALLVTGFGANHTNNAFALDDLAVAANPLH* |
| Ga0103862_10271321 | 3300009249 | River Water | AIRYSSINNVKLTLALLMTGFGANYTNDALALDDLAVAADPLH* |
| Ga0103869_101620111 | 3300009257 | River Water | IRAIRYSSINNVKLTLALLMTRFGANHTNDAFALDDLAVAADPLH* |
| Ga0115591_11986143 | 3300009586 | Wetland | MRYSSINHVKLTLTLLMTRFHADDADDALALDDLAVAADPLD* |
| Ga0116227_102316651 | 3300009709 | Host-Associated | MLTPAIRAMRYSSINNVKLTLALFVTRFCADNTNYAFALDDFAVAADPLD* |
| Ga0116226_100847866 | 3300009787 | Host-Associated | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAANPLD* |
| Ga0129336_103786953 | 3300010370 | Freshwater To Marine Saline Gradient | MLTPAIRAMRYSSINNVKLTLALLMAGLGANHANNAFALDDLAIAADPLH* |
| Ga0126355_102032225 | 3300010855 | Boreal Forest Soil | MRYSSINNVKLTLALFMTRFCANNTNHAFALDDLTVAADPLD* |
| Ga0105246_109844761 | 3300011119 | Miscanthus Rhizosphere | INNVKLTLALLMARFGADHTNDTIALDDFAVAADPLD* |
| Ga0150983_151369635 | 3300011120 | Forest Soil | MRYSSINNVKLTLALFMAWFRANDTNYTLALDDLTVAADPLD* |
| Ga0150985_1063841663 | 3300012212 | Avena Fatua Rhizosphere | LWFGMLTPAIRAIRYSSKLTLTLLVTRLHADDADHTFALDDLAVTANALD* |
| Ga0118559_1023861 | 3300012235 | Human Skin | INNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118434_1012141 | 3300012329 | Human Skin | TVCWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118154_1021913 | 3300012332 | Human Skin | CWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118040_1062511 | 3300012335 | Human Skin | VYPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118608_1012693 | 3300012463 | Human Skin | NVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118196_1057911 | 3300012621 | Human Skin | AFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118321_1022841 | 3300012649 | Human Skin | IRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0138285_11916321 | 3300012758 | Freshwater Lake | MRYSSINNVKLTLALLMTRLDTNDSNNALALNDLTVAADS |
| Ga0138269_10147982 | 3300012778 | Freshwater Lake | AIRAMRYSSINNVKLTLALFMARLCANNTNHAFALDDLTVAADPLD* |
| Ga0138269_10598773 | 3300012778 | Freshwater Lake | TPAIRAIRYSSINNVKLTLALLMTRLCANNTNHALALDDLTVAADPLN* |
| Ga0138269_13002834 | 3300012778 | Freshwater Lake | MRYSSINNVKLTLALFMAWLCANYTNYAFALDDLTVAADPLD* |
| Ga0129337_13913541 | 3300012968 | Aqueous | MRYSSINNVKLTLALLMAGFGANHANNAFALDDLAVAADPLY* |
| Ga0118018_1049073 | 3300013152 | Human Skin | FTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118587_1070463 | 3300013179 | Human Skin | GVNVPNQVCWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118155_1120433 | 3300013228 | Human Skin | SINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118647_1131333 | 3300013246 | Human Skin | VKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118602_1163691 | 3300013251 | Human Skin | KFSPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118522_1013683 | 3300013265 | Human Skin | MRYSSINNVKLTLALLMARFCANHTNYAFALDDFAVAANPLN* |
| Ga0157372_105291533 | 3300013307 | Corn Rhizosphere | LTPAIRAIRYSSKLTLTLLVTRLDANHTDHAFALDDLAVAADPLD* |
| Ga0118449_1028693 | 3300013466 | Human Skin | VRPITVCWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0118149_1016172 | 3300013652 | Human Skin | ITVCWWLGTFTPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN* |
| Ga0182007_103723931 | 3300015262 | Rhizosphere | MLTPAIRAIRYSLELTLTLLVTSFHADYADHALALDDLAVAADALY* |
| Ga0180044_10703281 | 3300016682 | Freshwater | AIRYSSINNVKLTLTLFMTWFCAYNTNYAFALDDLAIAAYPLD |
| Ga0181503_12351801 | 3300016698 | Peatland | RYSSINNVKLTLALLVAWLCANNTNNTLALDDLTVAADPLN |
| Ga0181500_11273823 | 3300016728 | Peatland | GILTPAIRAIRYSSNNNVKLTLTLLVTWFCANNTNNAFAFDDLAIAANPLN |
| Ga0194135_103572583 | 3300018414 | Watersheds | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAADPLN |
| Ga0187842_11420051 | 3300018790 | Freshwater | AIRAMRYSSINNVKLTLALLMTRLDTNDSNNALALDDLTVTADSLY |
| Ga0181514_11906721 | 3300019268 | Peatland | SINNVKLTLALLMTRFCADNTNYALALDDLTVAADPLN |
| Ga0181512_13484052 | 3300019270 | Peatland | AIRYSSINNVKLTLTLFMTWFRANNTNNAFALDDLAIAANPLD |
| Ga0193702_10056163 | 3300019871 | Soil | MRYSSINNVKLTLALFMARLCANYTNHAFALDDLTVAADPLD |
| Ga0194113_110671782 | 3300020074 | Freshwater Lake | MRYSSINNVKLTLALLVTGFDTNHANNALALDDLAVAADPLY |
| Ga0208718_11001302 | 3300020565 | Freshwater | TLTPAIRAMRYSSINNVKLTLALLMTRLDTNDSNYALALNDLTVAADSLY |
| Ga0210403_101086734 | 3300020580 | Soil | MRYSSINNVKLTLALFMTGLCANYTNHAFALDDLTVAADPLD |
| Ga0194122_101292203 | 3300021092 | Freshwater Lake | VCWWLGILTPAIRAMRYSSINNVKLTLALLVTGFDTNHANNALALDDLAVAADPLY |
| Ga0214167_10587231 | 3300021136 | Freshwater | VCWWLGTLTPAIRAIRYSSKLTLTLLVTRLDADHTDHALALDDLAVAADPLD |
| Ga0213854_11426613 | 3300021855 | Watersheds | SINNVKLTLTLFMAWFGTNYANYTFALDDLAIAAYPLN |
| Ga0213846_10241502 | 3300021909 | Watersheds | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAAEPLD |
| Ga0213846_10920561 | 3300021909 | Watersheds | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAANPLD |
| Ga0242651_10014162 | 3300022511 | Soil | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDFAVAADPLD |
| Ga0242667_10155083 | 3300022513 | Soil | LGIFTPAIRAIRYSSINNVKLTLALLMTRFGADHTNNALALDDFAVAADPLD |
| Ga0242668_10514443 | 3300022529 | Soil | YSSINNVKLTLALHMTRFGADHTNDALALDDFAVAADPLD |
| Ga0242658_10421183 | 3300022530 | Soil | MRYSSINNVKLTLALFMAWLCANYTNYAFALDDLTVAADPLD |
| Ga0242660_10039721 | 3300022531 | Soil | IRYSSINNVKLTLALLMTRLCANNTNHALALDDLTVAADPLN |
| Ga0242655_100181993 | 3300022532 | Soil | MRYSSINNVKLTLALFMTRFCADDTNHAFALDDLTVAADPLD |
| Ga0242673_10418921 | 3300022716 | Soil | IRAIRYSSINNVKLTLTLFMTRFCANNTNHAFALDDLAIAAYPLN |
| Ga0247817_101525331 | 3300022751 | Plant Litter | VPFVIPQINNVKLTLALLMTRFDANYSNDALALDDLTV |
| Ga0247816_104512411 | 3300022930 | Plant Litter | VIPQINNVKLTLALLMTRFDANYSNNALALDDLTVAADPLN |
| Ga0255148_10759011 | 3300024306 | Freshwater | VLTPAIRAMRYSSINNVKLTLALLMAGLGANHANNAFALDDLAIAADPLH |
| Ga0256330_10131624 | 3300024481 | Freshwater | MRYSSINNVKLTLALLMTRFDTNHSNNAFALDDLAIAADSLY |
| Ga0256343_10272271 | 3300024541 | Freshwater | MRYSSINNVKLTLALLMAGLGANHANNAFALDDLA |
| Ga0255268_11034271 | 3300024572 | Freshwater | AIRAMRYSSINNVKLTLALLMTRFDTNHSNNAFALDDLAIAADSLY |
| Ga0255293_10596933 | 3300024851 | Freshwater | MRYSSINNVKLTLALLMTRLDTNDSNNAFALDDLTVAADSLY |
| Ga0209435_1001371 | 3300025206 | Arabidopsis Root | MRYSSINNVKLTLALFMTRFCADHTNYAFALDDFAVAADPLD |
| Ga0207427_1221691 | 3300025231 | Arabidopsis Rhizosphere | MRYSSINNVKLTLALFMARFCADNTNNAFAFDDFAVAADPLD |
| Ga0209437_100081247 | 3300025233 | Arabidopsis Rhizosphere | MRYSSINNVKLTLALFMTRFCADNTNNAFALDDFAVAADPLD |
| Ga0208496_11114783 | 3300025591 | Freshwater | RYSSINNVKLTLALLMTRLDTNDSNNALALDDLTVAADSLY |
| Ga0209913_100031247 | 3300026272 | Soil | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAV |
| Ga0209913_10150691 | 3300026272 | Soil | RYSSINNVKLTLALFMTRFCADNTNYAFALDDLTVAADPLD |
| Ga0255289_11462301 | 3300026571 | Freshwater | MRYSSINNVKLTLALLMAGFGANHANDALALDDLAIAADPLH |
| Ga0255075_10585693 | 3300027578 | Freshwater | INNVKLTLALLMTRLDTNDSNNALALDDLTVAADSLY |
| Ga0255254_10483581 | 3300028105 | Freshwater | MRYSSINNVKLTLALLMTRLDTNDSNNALALDDLTVA |
| Ga0302201_102665823 | 3300028785 | Bog | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAADPLD |
| Ga0311358_107644833 | 3300029915 | Bog | FTPAIRAIRYSSINNVKLTLTLFMTWFCAYNTNYAFALDDLAIAAYPLN |
| Ga0302148_11811693 | 3300029916 | Bog | PAIRAIRYSSINNVKLTLTLFMTRFCANNTNHAFALDDLAIAAYPLN |
| Ga0311326_105769631 | 3300029917 | Bog | TPAIRAIRYSSINNVKLTLALLMTRLRADDTNHALALDDLTVAADPLN |
| Ga0311346_101703466 | 3300029952 | Bog | YSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAADPLD |
| Ga0311346_101806091 | 3300029952 | Bog | TPAIRAMRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAAEPLD |
| Ga0302194_102263951 | 3300030506 | Bog | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAIAAYPLN |
| Ga0074002_144674703 | 3300031086 | Soil | MRYSSINNVKLTLALFMTRFCANYTNHAFALDDLTVAADPLD |
| Ga0308156_11171973 | 3300031112 | Phyllosphere | CWWLGTLTPAIRAIRYSSKLTLTLLVTRLDADHTDHALALDDLAVAADPLD |
| Ga0311364_114714142 | 3300031521 | Fen | MRYSSINNVKLTLALFMTRFCADNTNYAFALDDLAVAAEPLN |
| Ga0318567_106595283 | 3300031821 | Soil | RYSSINNVKLTLALLVAWFCADNTNDTLALDDLAVAANPLN |
| Ga0308173_111475431 | 3300032074 | Soil | WLGMLTPAIRAIRYSSKLTLTLLVTRLHADDADHTLALDDLAVAADALN |
| Ga0314757_10621151 | 3300033534 | Switchgrass Phyllosphere | TPAIRAIRYSSKLTLTLLMTWFHADYADYAFALDDLAVAADPLD |
| Ga0334986_0191530_730_858 | 3300034012 | Freshwater | MRYSSINNVKLTLALLMAGLGANHANNAFALDDLAIAADPLH |
| ⦗Top⦘ |